Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 154 / 3e-48 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT2G14580 144 / 2e-44 ATPRB1 basic pathogenesis-related protein 1 (.1) AT4G33720 142 / 8e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 132 / 6e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 129 / 9e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 126 / 2e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 123 / 2e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 114 / 1e-32 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT5G57625 111 / 4e-31 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G50060 108 / 2e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020493 [exp] 244 / 9e-84 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 181 / 8e-59 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 147 / 7e-46 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10007102 [exp] 143 / 9e-44 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 129 / 2e-38 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 127 / 1e-37 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 120 / 9e-35 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10012478 [exp] 120 / 9e-35 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10006980 [exp] 106 / 2e-29 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083300 [exp] 169 / 2e-54 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 169 / 4e-54 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 162 / 2e-51 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 152 / 4e-47 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 144 / 2e-44 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 142 / 1e-43 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288401 [exp] 140 / 3e-43 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 124 / 1e-36 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082800 [exp] 117 / 6e-34 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 110 / 8e-31 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10012479 pacid=23145774 polypeptide=Lus10012479 locus=Lus10012479.g ID=Lus10012479.BGIv1.0 annot-version=v1.0 ATGTCGACTGTATACATTTCCTCCATTTTCCTTCTCATTACCCTAACATTACTGGCAACACTAACCCTCCCTTCATCCGCACAAGACTCCCCACAGGACT ACGTCAACGCCCACAACGCAGCCCGCTCCGCTGTCGGAGTGGGGCCTGTAACGTGGGACGCTGCCGTGGCAGCCTACGCGCAGTCCTACGCAAGGCAGCG TGCAGCGGGGGACTGCAAGCTGGTCCACTCCGGCGGGCCCTATGGTGAAAACCTAGCTTGGAGCAGCGGCCAGATGTCGGCTAACGGTGCGGTTGGGATG TGGGTTAACGAGAAGGCGGATTACAACTACAACGCCAACACATGCGCTCCGGGCAAAGTTTGCGGCCACTACACCCAGGTTGTGTGGAGGAGCACCGCCC GTATCGGGTGCGCCAAGGCGGCATGCAGCGGTGGAAAGGGCACTTTCGTCATTTGCAACTACACTCCTCGTGGCAATATCGTCGGCCGCAAACCTTACTA A
AA sequence Show only first row Show all	>Lus10012479 pacid=23145774 polypeptide=Lus10012479 locus=Lus10012479.g ID=Lus10012479.BGIv1.0 annot-version=v1.0 MSTVYISSIFLLITLTLLATLTLPSSAQDSPQDYVNAHNAARSAVGVGPVTWDAAVAAYAQSYARQRAAGDCKLVHSGGPYGENLAWSSGQMSANGAVGM WVNEKADYNYNANTCAPGKVCGHYTQVVWRSTARIGCAKAACSGGKGTFVICNYTPRGNIVGRKPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012479 [exp]	0	1
AT2G41480			Peroxidase superfamily protein...		Lus10020826 [exp]	3.3	0.9322
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10040037 [exp]	5.2	0.9145
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10037209 [exp]	6.9	0.9225
AT4G16260			Glycosyl hydrolase superfamily...		Lus10037749 [exp]	7.7	0.9202
AT1G03220			Eukaryotic aspartyl protease f...		Lus10034036 [exp]	9.5	0.9088
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013921 [exp]	13.9	0.9124
AT3G05550			Hypoxia-responsive family prot...		Lus10033002 [exp]	14.0	0.9215
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10019800 [exp]	15.2	0.9148
AT3G25130			unknown protein		Lus10038199 [exp]	16.4	0.8665
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013922 [exp]	17.5	0.9032

Compare expression of checked genes

Lus10012479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.