Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G07990 42 / 3e-06 Chaperone DnaJ-domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032795 [exp] 101 / 2e-28 AT4G07990 261 / 2e-88 Chaperone DnaJ-domain superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G146600 [exp] 62 / 2e-13 AT4G07990 235 / 3e-78 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.002G114600 [exp] 42 / 3e-06 AT4G07990 216 / 3e-71 Chaperone DnaJ-domain superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012483 pacid=23149344 polypeptide=Lus10012483 locus=Lus10012483.g ID=Lus10012483.BGIv1.0 annot-version=v1.0 ATGGCGGATGAAGATAGAAATCGTAATAAGAGCGATCCCCAGCCGCAGCCAAGTAGTAGTTATCCGGAGAAAGGTGAAGGCATGAAGCTTTGGGGAATTT TGATATTCGGTGTAATTGGCGCCACCGCCACCACTTTAGCAGTTACTCAGCTGCGGAGAACTGTTGATTGGTTCTACTTGCAGGTATCGAGATCATTTAC TACCTGA
AA sequence Show only first row Show all	>Lus10012483 pacid=23149344 polypeptide=Lus10012483 locus=Lus10012483.g ID=Lus10012483.BGIv1.0 annot-version=v1.0 MADEDRNRNKSDPQPQPSSSYPEKGEGMKLWGILIFGVIGATATTLAVTQLRRTVDWFYLQVSRSFTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G07990			Chaperone DnaJ-domain superfam...		Lus10012483 [exp]	0	1
AT4G07990			Chaperone DnaJ-domain superfam...		Lus10012482 [exp]	1.0	0.8976
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10019188 [exp]	4.5	0.8547
AT1G49950	MYB	ATTRB1, TRB1	telomere repeat binding factor...		Lus10025203 [exp]	8.5	0.8234
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10043263 [exp]	13.4	0.8182
AT1G13750			Purple acid phosphatases super...		Lus10036902 [exp]	13.9	0.8450
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10011012 [exp]	18.8	0.7835
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	28.1	0.8035
AT3G24550		ATPERK1	proline-rich extensin-like rec...		Lus10014319 [exp]	28.4	0.7488
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10037089 [exp]	30.8	0.7958
AT3G16190			Isochorismatase family protein...		Lus10037581 [exp]	35.2	0.7783

Compare expression of checked genes

Lus10012483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.