Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23540 100 / 1e-27 Mov34/MPN/PAD-1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011716 [exp] 99 / 2e-29 AT5G23540 115 / 1e-33 Mov34/MPN/PAD-1 family protein (.1.2) Lus10035470 [exp] 102 / 4e-28 AT5G23540 601 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2) Lus10031085 [exp] 102 / 4e-28 AT5G23540 599 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2) Lus10042663 [exp] 102 / 4e-28 AT5G23540 616 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2) Lus10021746 [exp] 101 / 5e-28 AT5G23540 618 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G127900 [exp] 100 / 9e-28 AT5G23540 567 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2) Potri.014G032900 [exp] 100 / 1e-27 AT5G23540 563 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012494 pacid=23149345 polypeptide=Lus10012494 locus=Lus10012494.g ID=Lus10012494.BGIv1.0 annot-version=v1.0 ATGTTGAAATTGACTATTAAGTACAACAACACAGTGCAAGATGAAGACGAGCTGTCACCTAAGAAGCTGGCGATCGAACACGTAGGGAGGCAGGACGCAA AGAAACACCAGGAAGAAATTGTCTCTAATTTGATGTCTTCCAACATAGTTCAGACATTGGGTACCATGCTCGACACTGTTGCCTTCTAG
AA sequence Show only first row Show all	>Lus10012494 pacid=23149345 polypeptide=Lus10012494 locus=Lus10012494.g ID=Lus10012494.BGIv1.0 annot-version=v1.0 MLKLTIKYNNTVQDEDELSPKKLAIEHVGRQDAKKHQEEIVSNLMSSNIVQTLGTMLDTVAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10012494 [exp]	0	1
AT3G12000			S-locus related protein SLR1, ...		Lus10003420 [exp]	12.8	0.7654
AT1G20870			HSP20-like chaperones superfam...		Lus10018368 [exp]	17.2	0.8743
AT5G02260		ATHEXPALPHA1.10...	expansin A9 (.1)		Lus10023902 [exp]	18.0	0.8682
AT1G77100			Peroxidase superfamily protein...		Lus10028631 [exp]	25.4	0.8174
AT4G37390		AUR3, YDK1, GH3...	YADOKARI 1, AUXIN UPREGULATED ...		Lus10014869 [exp]	38.7	0.8235
AT3G07870			F-box and associated interacti...		Lus10026789 [exp]	57.4	0.7417
AT2G32390		GLR6, ATGLR3.5	glutamate receptor 3.5 (.1.2....		Lus10025426 [exp]	63.2	0.8055
					Lus10030774 [exp]	66.5	0.8181
AT2G38870			Serine protease inhibitor, pot...		Lus10024870 [exp]	70.6	0.8098
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Lus10013327 [exp]	76.2	0.7972

Compare expression of checked genes

Lus10012494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.