Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031024 [exp] 47 / 2e-07 AT1G48120 58 / 1e-09 hydrolases;protein serine/threonine phosphatases (.1) Lus10009735 [exp] 45 / 2e-07 ND / Lus10017810 [exp] 45 / 5e-07 AT1G48120 46 / 8e-06 hydrolases;protein serine/threonine phosphatases (.1) Lus10003103 [exp] 44 / 1e-06 ND / Lus10019582 [exp] 42 / 2e-06 ND / Lus10001602 [exp] 40 / 6e-05 ND / Lus10017785 [exp] 40 / 9e-05 AT4G00020 532 / 4e-174 MATERNAL EFFECT EMBRYO ARREST 43, EMBRYO SAC DEVELOPMENT ARREST 20, BREAST CANCER 2 like 2A (.1.2) Lus10010609 [exp] 37 / 0.0009 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012495 pacid=23149340 polypeptide=Lus10012495 locus=Lus10012495.g ID=Lus10012495.BGIv1.0 annot-version=v1.0 ATGGAAATGCCACCTGTCCAAATCGAGAAGCACATCATCCTCCGCTACATGGAGAAATCTGGTCTCCCATTAAGCCTATCATCGTGGACCGTCCAAGCTA TGACCGATAAACTCTCCATACACCACACATGTAGTAGAACTATCCAACCTCCTATGTCACCCACCGACTTAGAAGCAGCAAAGTCCATCTTGAACGCTGA CCAGCTAAGCTCTCGATACAGCTACGATAACACCACTGCCCCCACGTGTACGGACTCAGCTCCCTAA
AA sequence Show only first row Show all	>Lus10012495 pacid=23149340 polypeptide=Lus10012495 locus=Lus10012495.g ID=Lus10012495.BGIv1.0 annot-version=v1.0 MEMPPVQIEKHIILRYMEKSGLPLSLSSWTVQAMTDKLSIHHTCSRTIQPPMSPTDLEAAKSILNADQLSSRYSYDNTTAPTCTDSAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012495 [exp]	0	1
					Lus10000882 [exp]	3.3	0.9409
					Lus10001472 [exp]	5.3	0.8218
AT1G21000			PLATZ transcription factor fam...		Lus10005350 [exp]	5.5	0.8819
AT5G52605			Defensin-like (DEFL) family pr...		Lus10031095 [exp]	6.7	0.8819
					Lus10035508 [exp]	7.7	0.8819
					Lus10012269 [exp]	8.7	0.8819
AT3G18040		ATMPK9	MAP kinase 9 (.1.2)		Lus10038956 [exp]	9.5	0.8819
AT5G04347			Plant self-incompatibility pro...		Lus10029375 [exp]	10.2	0.8819
AT5G48540			receptor-like protein kinase-r...		Lus10030777 [exp]	11.0	0.8819
AT5G01140			Protein of unknown function (D...		Lus10040317 [exp]	11.5	0.6693

Compare expression of checked genes

Lus10012495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.