Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08890 214 / 1e-72 Protein of unknown function, DUF538 (.1.2) AT5G01610 206 / 1e-69 Protein of unknown function, DUF538 (.1) AT5G37070 204 / 7e-69 Protein of unknown function, DUF538 (.1) AT2G03350 129 / 3e-39 Protein of unknown function, DUF538 (.1) AT5G16380 59 / 8e-12 Protein of unknown function, DUF538 (.1) AT3G07470 57 / 6e-11 Protein of unknown function, DUF538 (.1) AT3G07460 52 / 5e-09 Protein of unknown function, DUF538 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022674 [exp] 239 / 2e-82 AT3G08890 273 / 1e-94 Protein of unknown function, DUF538 (.1.2) Lus10002862 [exp] 228 / 2e-78 AT3G08890 299 / 2e-105 Protein of unknown function, DUF538 (.1.2) Lus10012232 [exp] 226 / 3e-77 AT3G08890 297 / 1e-104 Protein of unknown function, DUF538 (.1.2) Lus10030420 [exp] 124 / 4e-37 AT2G03350 259 / 1e-89 Protein of unknown function, DUF538 (.1) Lus10026639 [exp] 124 / 5e-37 AT2G03350 262 / 1e-90 Protein of unknown function, DUF538 (.1) Lus10037126 [exp] 114 / 3e-33 AT2G03350 235 / 3e-80 Protein of unknown function, DUF538 (.1) Lus10036804 [exp] 111 / 4e-32 AT2G03350 224 / 9e-76 Protein of unknown function, DUF538 (.1) Lus10009855 [exp] 71 / 2e-16 AT1G02816 169 / 2e-54 Protein of unknown function, DUF538 (.1) Lus10020218 [exp] 52 / 5e-09 AT5G16380 157 / 3e-49 Protein of unknown function, DUF538 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104000 [exp] 214 / 1e-72 AT3G08890 296 / 1e-104 Protein of unknown function, DUF538 (.1.2) Potri.016G125300 [exp] 208 / 2e-70 AT3G08890 292 / 8e-103 Protein of unknown function, DUF538 (.1.2) Potri.010G162400 [exp] 137 / 2e-42 AT2G03350 277 / 1e-96 Protein of unknown function, DUF538 (.1) Potri.008G092500 [exp] 130 / 1e-39 AT2G03350 281 / 4e-98 Protein of unknown function, DUF538 (.1) Potri.005G024000 [exp] 70 / 1e-15 AT1G02816 186 / 1e-60 Protein of unknown function, DUF538 (.1) Potri.013G014600 [exp] 69 / 2e-15 AT1G02816 181 / 8e-59 Protein of unknown function, DUF538 (.1) Potri.014G127500 [exp] 67 / 7e-15 AT4G02370 167 / 1e-53 Protein of unknown function, DUF538 (.1) Potri.001G084200 [exp] 37 / 0.0008 AT4G24130 208 / 5e-70 Protein of unknown function, DUF538 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04398 [flax] [poplar] DUF538 Protein of unknown function, DUF538
Representative CDS sequence Show only first row Show all	>Lus10012498 pacid=23143816 polypeptide=Lus10012498 locus=Lus10012498.g ID=Lus10012498.BGIv1.0 annot-version=v1.0 ATGCAGAAGCCATTGCCGGAGCTGCTAAAGGAGCACGATTTGCCCGTAGGAATCTTTCCTCGCGACGCCACAAACTACGAATTCGACGAAGAGACGCGCA GGCTGACTGTCTTCATCCCTCAAATGTGTGATGTCGGGTACAAGGACTCGTCTGTGCTTCGATTCGCCACCACCGTGACCGGCTATCTCGAAAAGGGGAG ATTGTCCGACGTGGAAGGGATGAAGACTAAGGTGATGATTTGGGTTAAAGTGACTTGTGTAACTTCCGAGGGATCCAAGGTTCATTTCACAGGTGGAATG AAGAAAACCAGGAGCAGAGATGCTTACGAGGTTCTTCGAGATGGAATCCGTATAGAGAAGTTCTAA
AA sequence Show only first row Show all	>Lus10012498 pacid=23143816 polypeptide=Lus10012498 locus=Lus10012498.g ID=Lus10012498.BGIv1.0 annot-version=v1.0 MQKPLPELLKEHDLPVGIFPRDATNYEFDEETRRLTVFIPQMCDVGYKDSSVLRFATTVTGYLEKGRLSDVEGMKTKVMIWVKVTCVTSEGSKVHFTGGM KKTRSRDAYEVLRDGIRIEKF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08890			Protein of unknown function, D...		Lus10012498 [exp]	0	1
					Lus10039892 [exp]	1.0	0.9780
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10023765 [exp]	7.9	0.9137
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	10.1	0.9689
AT5G36930			Disease resistance protein (TI...		Lus10007812 [exp]	11.6	0.8880
AT5G24070			Peroxidase superfamily protein...		Lus10027049 [exp]	12.4	0.9689
					Lus10032841 [exp]	12.6	0.9321
					Lus10008789 [exp]	14.3	0.9689
AT3G16857	GARP	ARR1	response regulator 1 (.1.2)		Lus10039345 [exp]	16.0	0.9689
AT2G23200			Protein kinase superfamily pro...		Lus10012646 [exp]	16.2	0.8905
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10014217 [exp]	17.5	0.9689

Compare expression of checked genes

Lus10012498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.