Lus10012503 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 169 / 4e-52 Thioredoxin superfamily protein (.1)
AT4G12890 160 / 5e-49 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT5G01580 158 / 3e-48 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 155 / 6e-47 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 150 / 6e-45 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 138 / 2e-40 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022669 395 / 1e-141 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10026384 168 / 1e-51 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10042270 168 / 2e-51 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10002203 164 / 3e-50 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10022670 129 / 3e-34 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 108 / 7e-27 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G107600 191 / 1e-60 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 191 / 2e-60 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.016G122200 189 / 1e-59 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.016G121900 187 / 2e-59 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.006G103000 171 / 6e-53 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.009G076200 168 / 7e-52 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.016G122000 151 / 1e-45 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
Potri.001G281004 151 / 3e-45 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Lus10012503 pacid=23143821 polypeptide=Lus10012503 locus=Lus10012503.g ID=Lus10012503.BGIv1.0 annot-version=v1.0
ATGGCTTCTCCATTTCTCTCCTTTCTCCTCCTCTCTTCTTTGCTCTTCTCACCAATTCGATCTGACGATGGCTTTTTCGACGAGAAGGACGAGTCTGATC
GAGTCAACTTGACTCTGTACTACGAAACTCGCTGCCCTTACTGCCGCGACTTCATCGTGAACCCTCTCGCCAAAGCTATGGCTACCGATCTCATCGACAT
TGTCAATCTCAGACTCGTCCCTTGGGGCAATGCTTACATTGAAGGCTCCCGAGTCATTTGTCAGCACGGTGAAGATGAATGCTACCTTAACACGATACAC
GCCTGCATTCTCGCGATTGCGAAGCCGCGGTTCCAGTTCGAATTCATCAAGTGCACCGAGGAGGAATCGTCGAGTAACCCGTCAATTGTATGGAGAACTT
GTGCTAATGACTTGCGGTTCCCCCCAATTCCCATCGATGGTTGCTATTATAACGGAATGGGGAAGAAGCTTCTGCTGAATTATGGGGACGAGACTATGAC
CCTGAAGCCGCCTCTTAGAGGCGTACCGTGGGTTACTGTGAATGGTGTTCCGCTGAATCAGGATTTCGAGAAGTTCGTGTCGTATGTCTGCAAAGCGTAC
AGAGGCAAGTCGCTGCCTAATGCTTGCAGGAACCGTAGCTTCGACAGGAAGAAGGAAATCACAGAGCAATCGATCTGTTACAGAACATAA
AA sequence
>Lus10012503 pacid=23143821 polypeptide=Lus10012503 locus=Lus10012503.g ID=Lus10012503.BGIv1.0 annot-version=v1.0
MASPFLSFLLLSSLLFSPIRSDDGFFDEKDESDRVNLTLYYETRCPYCRDFIVNPLAKAMATDLIDIVNLRLVPWGNAYIEGSRVICQHGEDECYLNTIH
ACILAIAKPRFQFEFIKCTEEESSSNPSIVWRTCANDLRFPPIPIDGCYYNGMGKKLLLNYGDETMTLKPPLRGVPWVTVNGVPLNQDFEKFVSYVCKAY
RGKSLPNACRNRSFDRKKEITEQSICYRT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07080 Thioredoxin superfamily protei... Lus10012503 0 1
AT1G75690 LQY1 LOW QUANTUM YIELD OF PHOTOSYST... Lus10002040 2.8 0.9500
AT3G06670 binding (.1.2) Lus10021547 3.5 0.9545
AT2G35130 Tetratricopeptide repeat (TPR)... Lus10017134 3.5 0.9476
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10030091 3.9 0.9593
AT5G56850 unknown protein Lus10032679 6.5 0.9206
AT2G33450 Ribosomal L28 family (.1) Lus10023747 7.9 0.9559
AT5G39210 CRR7 chlororespiratory reduction 7 ... Lus10015380 8.0 0.9458
AT3G01550 ATPPT2 phosphoenolpyruvate (pep)/phos... Lus10013083 9.4 0.9322
AT2G47240 CER8, LACS1 LONG-CHAIN ACYL-COA SYNTHASE 1... Lus10002414 11.2 0.9102
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10017100 12.4 0.9474

Lus10012503 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.