Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08880 109 / 2e-31 unknown protein AT5G01570 63 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022668 [exp] 180 / 2e-59 AT3G08880 157 / 9e-49 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G122350 [exp] 119 / 1e-35 AT3G08880 124 / 2e-35 unknown protein Potri.012G107200 [exp] 87 / 2e-23 AT3G08880 81 / 7e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012504 pacid=23143878 polypeptide=Lus10012504 locus=Lus10012504.g ID=Lus10012504.BGIv1.0 annot-version=v1.0 ATGTTGAACGGGCAGATTGGGGATTTGGAAATGAAAAGAGTTTCCATTGAGGAGCAAAGCCAAGCTAGGAAGAAACTTGATCGAGAAGGGTTGAGAGCAC AGAAGAAGCTTTCGATGTATGCTTCAGTGACAAATATCATTCCGGACTTGGGTGATCGTTCCACAATCTCAGGGCACATTGTAGACAGGGAGAAACGAAT GGTTGAGAAGTTTGAATTAGACCCGACCGAGATGACTCCATTTGAAACATGCGACAACATTTGGAAGATGATAAATCGGCGATAA
AA sequence Show only first row Show all	>Lus10012504 pacid=23143878 polypeptide=Lus10012504 locus=Lus10012504.g ID=Lus10012504.BGIv1.0 annot-version=v1.0 MLNGQIGDLEMKRVSIEEQSQARKKLDREGLRAQKKLSMYASVTNIIPDLGDRSTISGHIVDREKRMVEKFELDPTEMTPFETCDNIWKMINRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08880			unknown protein		Lus10012504 [exp]	0	1
AT1G13790		FDM4	factor of DNA methylation 4, X...		Lus10032933 [exp]	1.7	0.8432
AT2G26470			unknown protein		Lus10038230 [exp]	5.0	0.8326
AT2G47640			Small nuclear ribonucleoprotei...		Lus10007876 [exp]	5.7	0.8416
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Lus10031078 [exp]	6.5	0.8413
AT1G26750			unknown protein		Lus10031376 [exp]	7.3	0.8183
AT3G13960	GRF	ATGRF5	growth-regulating factor 5 (.1...		Lus10004455 [exp]	11.7	0.8335
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10026413 [exp]	12.5	0.8064
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	19.8	0.7843
AT4G23060		IQD22	IQ-domain 22 (.1)		Lus10017841 [exp]	22.4	0.7715
AT5G02260		ATHEXPALPHA1.10...	expansin A9 (.1)		Lus10033801 [exp]	26.1	0.7585

Compare expression of checked genes

Lus10012504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.