Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08880 70 / 8e-16 unknown protein AT5G01570 69 / 2e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022668 [exp] 154 / 5e-49 AT3G08880 157 / 9e-49 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G122350 [exp] 95 / 1e-25 AT3G08880 124 / 2e-35 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012505 pacid=23143817 polypeptide=Lus10012505 locus=Lus10012505.g ID=Lus10012505.BGIv1.0 annot-version=v1.0 ATGGCGGATTCACTTGGGGGAACCGATTTGGAGAAGCTAATATCATGGAGCGACGACCTGGTAGCAGTGTTGAAGAAACAGACCAGCATTAATGCCTTGG CTCAGTGTCTTGATCAGTCCAAGGTCCTCCGCTCCTCTTGCGATGCGGAATTGGACGAGGTCCACACTTTGGTCGAAGATTATCAGAAGAAGATAAATGA ATGCAAGCAGAAGACAGACAAGGCGAAACTCGAGGCTGTTGATGATGCCGAGATAGATCGTTTACAGAAGGAGCTGGAAGCTGAGATTGAAAATGAACGT GCTTTACAAGAGGATCTCAGATAA
AA sequence Show only first row Show all	>Lus10012505 pacid=23143817 polypeptide=Lus10012505 locus=Lus10012505.g ID=Lus10012505.BGIv1.0 annot-version=v1.0 MADSLGGTDLEKLISWSDDLVAVLKKQTSINALAQCLDQSKVLRSSCDAELDEVHTLVEDYQKKINECKQKTDKAKLEAVDDAEIDRLQKELEAEIENER ALQEDLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01570			unknown protein		Lus10012505 [exp]	0	1
AT5G42970		FUS4, EMB134, C...	FUSCA 8, FUSCA 4, EMBRYO DEFEC...		Lus10007164 [exp]	12.1	0.7669
AT1G77470		EMB2810, RFC5, ...	replication factor C 5, EMBRYO...		Lus10018144 [exp]	29.7	0.7562
AT5G20200			nucleoporin-related (.1)		Lus10043265 [exp]	81.0	0.7021
AT1G48380		HYP7, RHL1	HYPOCOTYL 7, root hair initiat...		Lus10041983 [exp]	177.3	0.6787
AT1G67230		CRWN1, LINC1	CROWDED NUCLEI 1, little nucle...		Lus10034075 [exp]	234.5	0.6701

Compare expression of checked genes

Lus10012505 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.