Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51770 60 / 1e-11 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) AT5G58550 45 / 1e-06 EOL2 ETO1-like 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022660 [exp] 150 / 2e-43 AT3G51770 1231 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031859 [exp] 50 / 4e-08 AT3G51770 1088 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031289 [exp] 49 / 1e-07 AT3G51770 1083 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G103400 [exp] 66 / 1e-13 AT3G51770 1399 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.016G123800 [exp] 65 / 2e-13 AT3G51770 1415 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.009G075300 [exp] 52 / 8e-09 AT3G51770 1206 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.001G280100 [exp] 44 / 3e-06 AT3G51770 1192 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012511 pacid=23143893 polypeptide=Lus10012511 locus=Lus10012511.g ID=Lus10012511.BGIv1.0 annot-version=v1.0 ATGAAGCCTATATTGCGGAGCTTGAAGTTTATTGAGACATGTAAAAGCTCCCATCTTTACGCCCTTCAATCCAGCAGCGGTGGCACCGGCAGCTCATCCG GCCCCGGCCATAGCCGGGGCGGTAGCGTCAGCGAGAGGATCCTAAGCCATATCCAGGAGTTTCGATGTAGTACTTCCAAGCCCTCTCGGAATACACCTCC GCCGCCGGCGGAAAATCTGATGCCTTGCGGCCTTCCGGAGACGGATATAATGGAGCCGCGGATAGAGCCAAACCTCAAACCCTTGGATCTGATCGAAAGC CTGGCCGATTTGTACTGA
AA sequence Show only first row Show all	>Lus10012511 pacid=23143893 polypeptide=Lus10012511 locus=Lus10012511.g ID=Lus10012511.BGIv1.0 annot-version=v1.0 MKPILRSLKFIETCKSSHLYALQSSSGGTGSSSGPGHSRGGSVSERILSHIQEFRCSTSKPSRNTPPPPAENLMPCGLPETDIMEPRIEPNLKPLDLIES LADLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012511 [exp]	0	1
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Lus10041050 [exp]	4.7	0.8316
AT1G03055			unknown protein		Lus10024837 [exp]	5.8	0.8001
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10031033 [exp]	9.4	0.7844
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10034957 [exp]	10.5	0.7844
AT1G70780			unknown protein		Lus10039287 [exp]	11.5	0.7844
					Lus10027606 [exp]	13.3	0.7664
AT2G14440			Leucine-rich repeat protein ki...		Lus10005049 [exp]	14.1	0.7543
AT1G33720		CYP76C6	"cytochrome P450, family 76, s...		Lus10006323 [exp]	19.2	0.7265
AT4G37840		HKL3	hexokinase-like 3 (.1)		Lus10011584 [exp]	23.0	0.7159
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Lus10024065 [exp]	23.2	0.7468

Compare expression of checked genes

Lus10012511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.