Lus10012525 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023787 118 / 2e-32 ND 44 / 3e-04
Lus10001889 107 / 9e-31 AT1G52950 42 / 6e-05 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10042979 112 / 7e-30 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10025008 111 / 1e-29 AT5G08020 64 / 9e-11 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10027612 110 / 4e-29 AT1G52950 49 / 1e-05 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10006887 100 / 7e-26 AT4G19130 63 / 7e-10 Replication factor-A protein 1-related (.1)
Lus10010590 100 / 2e-25 ND /
Lus10008725 92 / 1e-24 ND 38 / 0.003
Lus10003025 91 / 1e-22 AT5G61000 57 / 2e-08 Replication factor-A protein 1-related (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012525 pacid=23143860 polypeptide=Lus10012525 locus=Lus10012525.g ID=Lus10012525.BGIv1.0 annot-version=v1.0
ATGTGGAAGCTCTGCAATCCGGCCGAACCAGCTAAACTTTTCGCCCTAGGGACGCTTTGGACAGATGCAGAGGATACTCGGATTCCGGGCGATATGTTGC
GCTCTTTTGCTGCTGACTTGGACAAATGCATCTCGGTCGGGTCCATCTACACTGTCGCGGGTTATACCCTTCGATCTCCCAGGCCGACCTACCGTGGTTG
TCTGTTTCCTCATTGGCTCGACCTCACGCTGACTCCAACAGTTCTGTTGGAGTCAGCGTCTACTGATGCAACTTTCAAACCTGAATCTTACAAGTTTGTT
CCCTTCTCTGAATTTCTGACCGTATCACACCTGGCTTCCCCTTCTTGA
AA sequence
>Lus10012525 pacid=23143860 polypeptide=Lus10012525 locus=Lus10012525.g ID=Lus10012525.BGIv1.0 annot-version=v1.0
MWKLCNPAEPAKLFALGTLWTDAEDTRIPGDMLRSFAADLDKCISVGSIYTVAGYTLRSPRPTYRGCLFPHWLDLTLTPTVLLESASTDATFKPESYKFV
PFSEFLTVSHLASPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012525 0 1
AT3G07310 Protein of unknown function (D... Lus10025896 6.6 0.9146
AT1G18330 MYB RVE7, EPR1 REVEILLE 7, EARLY-PHYTOCHROME-... Lus10031322 8.7 0.8947
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10000076 11.9 0.9058
AT5G05140 Transcription elongation facto... Lus10039000 14.5 0.8919
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10036773 17.5 0.8608
AT5G65210 bZIP TGA1 bZIP transcription factor fami... Lus10037550 19.4 0.8993
AT5G27830 unknown protein Lus10029881 19.7 0.8940
AT5G47040 LON2 lon protease 2 (.1) Lus10001083 21.8 0.8786
AT3G02750 Protein phosphatase 2C family ... Lus10021486 22.4 0.8789
AT4G29800 PLP8, PLAIVD ,P... PATATIN-like protein 8 (.1.2) Lus10023512 23.7 0.8834

Lus10012525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.