Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27130 101 / 1e-26 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041563 [exp] 173 / 7e-52 AT3G27120 679 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G331200 [exp] 99 / 3e-25 AT3G27120 661 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012529 pacid=23143844 polypeptide=Lus10012529 locus=Lus10012529.g ID=Lus10012529.BGIv1.0 annot-version=v1.0 ATGGCGAACGCGAGCGATGCTTCCCCAAGTTGGAGGAAGCAAGTCGACGATAACCTCAATCGACTCCATTCCCTCAAATTCGGCGCCGATAAGGTGCTGG AGAACGGCGATTTCTCCACTTCCTACGTGTTGGGCCTTCGCCTCATTGGCTTCCTTGACTCGCATTCTCTATCTGACGCCGTCGAAGCTCTCACCCGCCC TATCCGTCGGGAAGCTCTCTCCAAGCTCGATTCCGCGCGCCGTGCTCTAGTTCCTGATTCTGACAGGGATTTTGGAGGCCGTACTTGTGAACTACCTAAT CAGTTCGTGCGTTTGATAATCGGTCTTCCGCTTTCTGTTGAGACGAGCGTTTGA
AA sequence Show only first row Show all	>Lus10012529 pacid=23143844 polypeptide=Lus10012529 locus=Lus10012529.g ID=Lus10012529.BGIv1.0 annot-version=v1.0 MANASDASPSWRKQVDDNLNRLHSLKFGADKVLENGDFSTSYVLGLRLIGFLDSHSLSDAVEALTRPIRREALSKLDSARRALVPDSDRDFGGRTCELPN QFVRLIIGLPLSVETSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27130			unknown protein		Lus10012529 [exp]	0	1
AT3G19050		POK2	phragmoplast orienting kinesin...		Lus10027934 [exp]	4.6	0.9439
AT5G51660		CPSF160, ATCPSF...	cleavage and polyadenylation s...		Lus10031111 [exp]	7.1	0.9385
AT5G51660		CPSF160, ATCPSF...	cleavage and polyadenylation s...		Lus10031692 [exp]	8.1	0.9357
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Lus10004531 [exp]	11.7	0.9327
AT3G06530			ARM repeat superfamily protein...		Lus10008676 [exp]	14.8	0.9329
AT3G19050		POK2	phragmoplast orienting kinesin...		Lus10012048 [exp]	15.5	0.9344
AT5G05560		EMB2771, APC1	EMBRYO DEFECTIVE 2771, E3 ubiq...		Lus10007498 [exp]	15.7	0.9312
AT1G23790			Plant protein of unknown funct...		Lus10013007 [exp]	16.4	0.9299
AT2G05120			Nucleoporin, Nup133/Nup155-lik...		Lus10001170 [exp]	19.2	0.9276
AT1G15440		ATPWP2	\(PERIODIC TRYPTOPHAN PROTEIN ...		Lus10043473 [exp]	22.9	0.9200

Compare expression of checked genes

Lus10012529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.