Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27100 126 / 6e-39 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041556 [exp] 195 / 4e-66 AT3G27100 150 / 2e-48 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G330400 [exp] 171 / 1e-56 AT3G27100 130 / 2e-40 unknown protein Potri.017G069200 [exp] 164 / 7e-54 AT3G27100 131 / 7e-41 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10163 [flax] [poplar] EnY2 Transcription factor e(y)2
Representative CDS sequence Show only first row Show all	>Lus10012534 pacid=23143808 polypeptide=Lus10012534 locus=Lus10012534.g ID=Lus10012534.BGIv1.0 annot-version=v1.0 ATGAGGAAATCGGTGAATCGACCTCCGACGCCGGACGCGGCGGAGGAGCAGCAGAAGGAGCCCTCGTTTCATGAAATTATCAACGTCAAGTTGGTTGAAA GCGGGGAGAAGGAGCGATTAATGGAGCTGCTGAGGGAGAGGTTGATAGAGTGTGGCTGGAAAGACGAGATGAAAGCTCTCTGCAGGGCTTTCATTAAGAA GAAAGGCAGGGATAATGTGACTGTGGATGACCTTGTACATGTGATTACACCAAAAGGCAGAGCATCGATTCCTGATGCAGTAAAGGCTGAGCTATTGCAA AGAATTCGTATGTTCCTAGTTCAATCCTCCGTGTAG
AA sequence Show only first row Show all	>Lus10012534 pacid=23143808 polypeptide=Lus10012534 locus=Lus10012534.g ID=Lus10012534.BGIv1.0 annot-version=v1.0 MRKSVNRPPTPDAAEEQQKEPSFHEIINVKLVESGEKERLMELLRERLIECGWKDEMKALCRAFIKKKGRDNVTVDDLVHVITPKGRASIPDAVKAELLQ RIRMFLVQSSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27100			unknown protein		Lus10012534 [exp]	0	1
AT2G36410			Family of unknown function (DU...		Lus10023876 [exp]	1.4	0.8756
AT3G27100			unknown protein		Lus10041556 [exp]	2.4	0.8512
AT5G19930			Protein of unknown function DU...		Lus10017753 [exp]	2.4	0.8584
AT5G11900			Translation initiation factor ...		Lus10024986 [exp]	5.9	0.8345
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10000601 [exp]	7.2	0.8399
AT5G60335			Thioesterase superfamily prote...		Lus10009162 [exp]	10.5	0.8107
AT4G07990			Chaperone DnaJ-domain superfam...		Lus10012482 [exp]	10.7	0.8338
AT5G59610			Chaperone DnaJ-domain superfam...		Lus10016510 [exp]	13.2	0.8211
AT5G11600			unknown protein		Lus10001603 [exp]	13.8	0.8019
AT2G37120			S1FA-like DNA-binding protein ...		Lus10023177 [exp]	14.0	0.8080

Compare expression of checked genes

Lus10012534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.