Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50460 82 / 4e-22 secE/sec61-gamma protein transport protein (.1) AT4G24920 82 / 4e-22 secE/sec61-gamma protein transport protein (.1) AT3G48570 76 / 7e-20 secE/sec61-gamma protein transport protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041552 [exp] 102 / 6e-30 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10035206 [exp] 90 / 4e-25 AT5G50460 127 / 1e-40 secE/sec61-gamma protein transport protein (.1) Lus10019065 [exp] 60 / 4e-13 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1) Lus10032037 [exp] 0 / 1 AT3G48560 96 / 3e-23 TRIAZOLOPYRIMIDINE RESISTANT 5, IMIDAZOLE RESISTANT 1, ACETOLACTATE SYNTHASE, ACETOHYDROXY ACID SYNTHASE, chlorsulfuron/imidazolinone resistant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G329400 [exp] 84 / 5e-23 AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) Potri.012G098400 [exp] 81 / 7e-22 AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1) Potri.015G097300 [exp] 81 / 1e-21 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1) Potri.017G064032 [exp] 62 / 3e-14 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00584 [flax] [poplar] SecE SecE/Sec61-gamma subunits of protein translocation complex
Representative CDS sequence Show only first row Show all	>Lus10012539 pacid=23143818 polypeptide=Lus10012539 locus=Lus10012539.g ID=Lus10012539.BGIv1.0 annot-version=v1.0 ATGGACGCCATTGACAACGTCTTCGATCCACTCAGGGAGTTCGCCAAGGACAGCGTCCGCCTCGTCAAGCGTTGCCACAAGCCCGATCGGAAAGAATTTT CCAAGGTTGCGGTGCGAACGGCGATAGGGTTCGTTGTGATGGGATTTGTGGGGTTCTTCGTCAAGCTCATCTTCATCCCCATCAACAACATCATCGTCGG ATCTGGTGGCGTTGGGAAGCATGGAGCAGCTGCTGGGGGAATTTCTGCCGCATCTGATGAAGAGATTAGACAACACAACCCAATGTAG
AA sequence Show only first row Show all	>Lus10012539 pacid=23143818 polypeptide=Lus10012539 locus=Lus10012539.g ID=Lus10012539.BGIv1.0 annot-version=v1.0 MDAIDNVFDPLREFAKDSVRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSGGVGKHGAAAGGISAASDEEIRQHNPM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50460			secE/sec61-gamma protein trans...		Lus10012539 [exp]	0	1
AT1G13750			Purple acid phosphatases super...		Lus10036904 [exp]	1.4	0.8613
AT1G70780			unknown protein		Lus10031920 [exp]	4.2	0.8119
AT5G47960		SMG1, AtRABA4c	SMALL MOLECULAR WEIGHT G-PROTE...		Lus10002725 [exp]	7.2	0.7984
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Lus10001354 [exp]	7.4	0.7970
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10008081 [exp]	7.5	0.8018
AT5G20050			Protein kinase superfamily pro...		Lus10033032 [exp]	17.2	0.7120
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10030871 [exp]	17.5	0.7702
AT3G51580			unknown protein		Lus10025224 [exp]	18.3	0.7457
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10040456 [exp]	19.1	0.7219
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10013113 [exp]	21.8	0.7946

Compare expression of checked genes

Lus10012539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.