Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40960 54 / 1e-11 Protein of unknown function (DUF 3339) (.1) AT5G63500 48 / 4e-09 Protein of unknown function (DUF 3339) (.1) AT3G48660 47 / 2e-08 Protein of unknown function (DUF 3339) (.1) AT5G08391 45 / 4e-08 Protein of unknown function (DUF 3339) (.1) AT5G40980 40 / 3e-06 Protein of unknown function (DUF 3339) (.1) AT3G27027 40 / 3e-06 Protein of unknown function (DUF 3339) (.1) AT3G27030 42 / 4e-06 unknown protein AT3G01940 37 / 6e-05 Protein of unknown function (DUF 3339) (.1) AT5G14110 37 / 6e-05 Protein of unknown function (DUF 3339) (.1) AT5G50660 37 / 8e-05 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041550 [exp] 76 / 2e-19 AT3G27030 122 / 8e-37 unknown protein Lus10035200 [exp] 65 / 9e-16 AT5G40960 81 / 2e-22 Protein of unknown function (DUF 3339) (.1) Lus10032031 [exp] 65 / 9e-16 AT5G40960 81 / 2e-22 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 47 / 2e-08 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 45 / 5e-08 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 45 / 5e-08 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 45 / 8e-08 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 43 / 3e-07 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 42 / 7e-07 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G328701 [exp] 67 / 4e-16 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064400 [exp] 66 / 4e-16 AT5G40960 49 / 1e-09 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 49 / 2e-09 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 47 / 5e-09 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 47 / 7e-09 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 46 / 2e-08 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 45 / 4e-08 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G065444 [exp] 44 / 8e-08 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 42 / 5e-07 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.017G064972 [exp] 39 / 9e-06 AT3G27027 108 / 3e-33 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10012541 pacid=23143864 polypeptide=Lus10012541 locus=Lus10012541.g ID=Lus10012541.BGIv1.0 annot-version=v1.0 ATGAAGGACTGGGCAGCTCCTCTGATAGCAGCAGCACTGTTTGCATTTCTGTCACCAGGTTTGGTGTTTCAGATCCCTGGCAAGGAAAGGCCTATCGATT TCATGAACATGAAGACAAGTTTTGCTTCCATGTTTGTTCACTTGGTCATCTTTGGTCTCCTCCTCATCTTGTTCCTCGTCCTTCTCGATCCCCACCTCTA TATCTAG
AA sequence Show only first row Show all	>Lus10012541 pacid=23143864 polypeptide=Lus10012541 locus=Lus10012541.g ID=Lus10012541.BGIv1.0 annot-version=v1.0 MKDWAAPLIAAALFAFLSPGLVFQIPGKERPIDFMNMKTSFASMFVHLVIFGLLLILFLVLLDPHLYI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40960			Protein of unknown function (D...		Lus10012541 [exp]	0	1
AT5G53590			SAUR-like auxin-responsive pro...		Lus10006820 [exp]	1.0	0.7821
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10043190 [exp]	5.3	0.6513
AT1G05660			Pectin lyase-like superfamily ...		Lus10010584 [exp]	15.0	0.6229
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10039024 [exp]	15.5	0.6295
AT5G45840			Leucine-rich repeat protein ki...		Lus10029228 [exp]	17.5	0.6187
					Lus10012543 [exp]	17.8	0.6427
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014438 [exp]	18.8	0.6467
AT5G61730		ABCA9, ATATH11	ARABIDOPSIS THALIANA ABC2 HOMO...		Lus10042172 [exp]	19.1	0.5951
					Lus10024501 [exp]	20.9	0.6350
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10003366 [exp]	25.5	0.6054

Compare expression of checked genes

Lus10012541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.