Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27030 114 / 2e-34 unknown protein AT5G40970 105 / 4e-32 Protein of unknown function (DUF 3339) (.1) AT3G48660 98 / 1e-28 Protein of unknown function (DUF 3339) (.1) AT5G63500 95 / 7e-28 Protein of unknown function (DUF 3339) (.1) AT5G08391 90 / 8e-26 Protein of unknown function (DUF 3339) (.1) AT5G14110 87 / 1e-24 Protein of unknown function (DUF 3339) (.1) AT3G01950 86 / 4e-24 Protein of unknown function (DUF 3339) (.1) AT3G27027 83 / 4e-23 Protein of unknown function (DUF 3339) (.1) AT5G40980 74 / 1e-19 Protein of unknown function (DUF 3339) (.1) AT5G50660 61 / 4e-14 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041551 [exp] 139 / 4e-45 AT3G27030 113 / 3e-34 unknown protein Lus10035199 [exp] 120 / 5e-38 AT3G27030 108 / 4e-32 unknown protein Lus10032030 [exp] 119 / 2e-37 AT3G27030 106 / 2e-31 unknown protein Lus10032029 [exp] 119 / 2e-36 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 95 / 1e-27 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 94 / 2e-27 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 94 / 2e-27 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 94 / 3e-27 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 92 / 3e-26 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064500 [exp] 125 / 4e-40 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 120 / 5e-38 AT3G27030 79 / 2e-20 unknown protein Potri.015G098200 [exp] 103 / 8e-31 AT3G27030 107 / 7e-31 unknown protein Potri.003G170400 [exp] 95 / 7e-28 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 95 / 1e-27 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 93 / 5e-27 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 89 / 2e-25 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 89 / 4e-25 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 87 / 2e-24 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 82 / 8e-22 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10012542 pacid=23143889 polypeptide=Lus10012542 locus=Lus10012542.g ID=Lus10012542.BGIv1.0 annot-version=v1.0 ATGGCTGACTGGGGTCCGATCTTGATAGGGGTGGTGCTATTTGTGCTGCTCACACCTGGGCTTCTCTTCCAGTTACCTGGCAACAACAGACAGCTCGAGT TTGGAAGCATGAAGACCAATGGGAAAGCCATTGCAGTCCACACTCTCATTTTCTTTGCTCTCTATGCTGTTCTCACCTTGGCTGTCCATATCCACATCTA CACTGGCTGA
AA sequence Show only first row Show all	>Lus10012542 pacid=23143889 polypeptide=Lus10012542 locus=Lus10012542.g ID=Lus10012542.BGIv1.0 annot-version=v1.0 MADWGPILIGVVLFVLLTPGLLFQLPGNNRQLEFGSMKTNGKAIAVHTLIFFALYAVLTLAVHIHIYTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27030			unknown protein		Lus10012542 [exp]	0	1
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10039010 [exp]	5.8	0.7890
AT5G52220			unknown protein		Lus10014990 [exp]	11.6	0.7253
AT1G65820			microsomal glutathione s-trans...		Lus10020792 [exp]	17.1	0.7688
AT3G07990		SCPL27	serine carboxypeptidase-like 2...		Lus10036516 [exp]	24.9	0.7803
AT3G15650			alpha/beta-Hydrolases superfam...		Lus10002034 [exp]	32.0	0.7462
AT4G30010			unknown protein		Lus10001623 [exp]	32.1	0.6863
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031726 [exp]	63.9	0.7221
					Lus10033479 [exp]	73.2	0.7450
AT4G39700			Heavy metal transport/detoxifi...		Lus10022508 [exp]	74.6	0.7227
					Lus10022950 [exp]	86.4	0.6917

Compare expression of checked genes

Lus10012542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.