Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27027 71 / 1e-17 Protein of unknown function (DUF 3339) (.1) AT5G40980 70 / 2e-17 Protein of unknown function (DUF 3339) (.1) AT3G48660 57 / 5e-12 Protein of unknown function (DUF 3339) (.1) AT5G63500 50 / 2e-09 Protein of unknown function (DUF 3339) (.1) AT5G14110 46 / 5e-08 Protein of unknown function (DUF 3339) (.1) AT3G01940 45 / 1e-07 Protein of unknown function (DUF 3339) (.1) AT3G27030 44 / 2e-06 unknown protein AT3G01950 42 / 2e-06 Protein of unknown function (DUF 3339) (.1) AT5G08391 35 / 0.0006 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041550 [exp] 109 / 3e-32 AT3G27030 122 / 8e-37 unknown protein Lus10032029 [exp] 72 / 2e-17 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 65 / 2e-15 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 64 / 1e-14 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 62 / 2e-14 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 62 / 4e-14 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10012542 [exp] 53 / 1e-10 AT3G27030 113 / 3e-34 unknown protein Lus10035198 [exp] 52 / 3e-10 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10041551 [exp] 51 / 8e-10 AT3G27030 113 / 3e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G328701 [exp] 77 / 2e-19 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064972 [exp] 64 / 3e-15 AT3G27027 108 / 3e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G058001 [exp] 60 / 3e-13 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 59 / 3e-13 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 55 / 2e-11 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 50 / 1e-09 AT3G27030 111 / 2e-33 unknown protein Potri.015G098200 [exp] 50 / 5e-09 AT3G27030 107 / 7e-31 unknown protein Potri.017G065444 [exp] 47 / 2e-08 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 45 / 1e-07 AT3G27030 79 / 2e-20 unknown protein Potri.012G100100 [exp] 42 / 2e-06 AT5G63500 79 / 1e-21 Protein of unknown function (DUF 3339) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012543 pacid=23143813 polypeptide=Lus10012543 locus=Lus10012543.g ID=Lus10012543.BGIv1.0 annot-version=v1.0 ATGGTGATAATACAGAAGAAAATGACAGCGTGGGTAAGAATGGCAATGGCACTTGTGTTGAGGTTCCCAAACTCCATCACTCTTGTTCTTGCAGGTATCT GGAACAGAAGGCCAGGTGATAACAGGATGAACAGCACCACCGCCACAATGACTGGTCCCCAATCCGCACCCATGATCATCATGATGATGATTCTCTTTGC TGGAATGTCTATTATGTTTCAGATTTGTGGTGGGATTCTCTTTATGATATCATTGATGAAAAAAGGAGAGGAAGGAAACAGAATGAAGTCTTAA
AA sequence Show only first row Show all	>Lus10012543 pacid=23143813 polypeptide=Lus10012543 locus=Lus10012543.g ID=Lus10012543.BGIv1.0 annot-version=v1.0 MVIIQKKMTAWVRMAMALVLRFPNSITLVLAGIWNRRPGDNRMNSTTATMTGPQSAPMIIMMMILFAGMSIMFQICGGILFMISLMKKGEEGNRMKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012543 [exp]	0	1
AT3G27030			unknown protein		Lus10041550 [exp]	3.6	0.7954
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10004260 [exp]	12.0	0.7291
					Lus10018114 [exp]	12.4	0.7209
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10041630 [exp]	13.4	0.7161
AT5G40960			Protein of unknown function (D...		Lus10012541 [exp]	17.8	0.6427
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10021638 [exp]	22.8	0.6619
					Lus10033284 [exp]	23.7	0.7457
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10007942 [exp]	25.1	0.7074
AT5G39030			Protein kinase superfamily pro...		Lus10027116 [exp]	27.1	0.7193
					Lus10001746 [exp]	28.1	0.6691

Compare expression of checked genes

Lus10012543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.