Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041547 [exp] 171 / 1e-56 ND 43 / 4e-06
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G065916 [exp] 63 / 7e-14 AT3G01960 / unknown protein Potri.001G328300 [exp] 59 / 4e-12 AT3G01960 54 / 6e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012546 pacid=23143859 polypeptide=Lus10012546 locus=Lus10012546.g ID=Lus10012546.BGIv1.0 annot-version=v1.0 ATGGAGTGCTCGAGCGGCCGGAAAAGAAGAGGTTTCTTGAAGAGCAAATTGCTCCCACTATACAGACCATCATCAGCTAAGCAGCAGCAGCAGCAGCAGC CTAATAACAACTACAGCTATTCTTCTCCTTCATCGTCCATGGCCTTTGCTGCCCCTGCAGTTGTCCCGAAGCAGAGTAGTTACATGGCGTCCGAGACGAT CAGTTACATGATGAAGCCAAGGAGGCAGCAGGTTGATCACAACAATAAGTTCTTCGGGGTGGTGGGTGATTGTCGAATTGATAGCAAAGCTTCTACTTAC ATCTCTACTGTTCAGGAGCGTTTCAAGCATCATGAACAATCTTACTGA
AA sequence Show only first row Show all	>Lus10012546 pacid=23143859 polypeptide=Lus10012546 locus=Lus10012546.g ID=Lus10012546.BGIv1.0 annot-version=v1.0 MECSSGRKRRGFLKSKLLPLYRPSSAKQQQQQQPNNNYSYSSPSSSMAFAAPAVVPKQSSYMASETISYMMKPRRQQVDHNNKFFGVVGDCRIDSKASTY ISTVQERFKHHEQSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01960			unknown protein		Lus10012546 [exp]	0	1
AT1G30280			Chaperone DnaJ-domain superfam...		Lus10005923 [exp]	3.9	0.8674
AT4G35780		STY17	serine/threonine/tyrosine kina...		Lus10012517 [exp]	4.2	0.8228
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10003378 [exp]	5.3	0.7984
AT1G49230			RING/U-box superfamily protein...		Lus10006787 [exp]	5.7	0.8124
AT2G16190			unknown protein		Lus10040480 [exp]	7.5	0.7164
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10011137 [exp]	9.6	0.8135
AT5G60250			zinc finger (C3HC4-type RING f...		Lus10036128 [exp]	10.5	0.7020
AT4G32290			Core-2/I-branching beta-1,6-N-...		Lus10001503 [exp]	12.0	0.7996
AT5G44005			unknown protein		Lus10003608 [exp]	14.5	0.7865
AT5G19120			Eukaryotic aspartyl protease f...		Lus10021939 [exp]	16.0	0.8007

Compare expression of checked genes

Lus10012546 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.