Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26960 149 / 7e-47 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 147 / 3e-46 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G13140 132 / 7e-39 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 44 / 3e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 43 / 1e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 42 / 4e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 40 / 9e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041541 [exp] 241 / 1e-83 AT5G41050 169 / 2e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10032018 [exp] 189 / 9e-63 AT5G41050 162 / 2e-51 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10035187 [exp] 186 / 3e-61 AT5G41050 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 43 / 1e-05 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 41 / 6e-05 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 41 / 8e-05 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 41 / 0.0001 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 41 / 0.0001 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 40 / 0.0002 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G326200 [exp] 199 / 8e-67 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 199 / 1e-66 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 165 / 1e-51 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 144 / 3e-43 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 54 / 2e-09 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 50 / 4e-08 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 46 / 6e-07 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 45 / 2e-06 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10012553 pacid=23143871 polypeptide=Lus10012553 locus=Lus10012553.g ID=Lus10012553.BGIv1.0 annot-version=v1.0 ATGGGTTTCGTTTACTGTGATATCTGCTCTAATAACAGCTTTACCAAACACAGCTACTTCATGCCAGGCGCAGAAGTCAGAATAGAGTGCAAGTTCAAAG CAAGTGCACCCAAAACGAGAGAGCAGATAGCATTCTCAGTAAACAGGACAACAAACAGGTACGGAATGTACAAATTAGAAATACCAGCTGTTGACGGGAT CGAGTGTGCAGAGTCAGCCATTGCATCGTCTTGTGAAGCAAGCTTGATGTGGACTCCCTCGAAATCATGCAACGTTCCCGGATACAGATCTACATCAGAT GAGATAGAGATCAAAGCCAGGCAACCAAATCTTTGCGTCTACAGCCTCAATGCATTGAATTTCAGACCCTCAAAGAGAAATGTCTCTATGTGTGGACATT AG
AA sequence Show only first row Show all	>Lus10012553 pacid=23143871 polypeptide=Lus10012553 locus=Lus10012553.g ID=Lus10012553.BGIv1.0 annot-version=v1.0 MGFVYCDICSNNSFTKHSYFMPGAEVRIECKFKASAPKTREQIAFSVNRTTNRYGMYKLEIPAVDGIECAESAIASSCEASLMWTPSKSCNVPGYRSTSD EIEIKARQPNLCVYSLNALNFRPSKRNVSMCGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10012553 [exp]	0	1
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	1.0	0.9194
AT2G40435			unknown protein		Lus10010217 [exp]	2.0	0.8669
AT1G67590			Remorin family protein (.1.2)		Lus10036996 [exp]	2.8	0.8747
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10020580 [exp]	5.0	0.8547
AT5G05180			unknown protein		Lus10030507 [exp]	6.0	0.8429
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10038636 [exp]	7.1	0.7952
AT2G02850		ARPN	plantacyanin (.1)		Lus10018938 [exp]	7.9	0.8228
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10016156 [exp]	7.9	0.8671
AT1G04590		EMB2748	unknown protein		Lus10015943 [exp]	11.2	0.8022
AT4G04190			unknown protein		Lus10006268 [exp]	11.5	0.7413

Compare expression of checked genes

Lus10012553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.