Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27435 104 / 4e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041533 [exp] 131 / 1e-41 AT1G27435 104 / 4e-31 unknown protein Lus10032003 [exp] 120 / 2e-37 AT1G27435 107 / 5e-32 unknown protein Lus10035173 [exp] 118 / 3e-36 AT1G27435 107 / 3e-32 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G325000 [exp] 112 / 5e-34 AT1G27435 103 / 1e-30 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012558 pacid=23143807 polypeptide=Lus10012558 locus=Lus10012558.g ID=Lus10012558.BGIv1.0 annot-version=v1.0 ATGGCAGGAGGAGCGTTTTGGGGAACAAGAGTAATGGAGATAGTGAAGAAGCATGACTCCGGAGGACTTGTCTGGAAAAGAATAAAGCTCACCCCTTCCC GTAAAGCCAACGCCAAAAAGCGCCTCCTCCGCGTCTGGCAGAATGAGGCTGTCTTGAGGGCATGCGCTGAACCACCACCTTCCACCACATCCGCAAACGA AGCAGCTGCAGTTGGAGAGGGAGATGCAGATGCTAATAATAACACCAATTCCTACTCAAGTTAG
AA sequence Show only first row Show all	>Lus10012558 pacid=23143807 polypeptide=Lus10012558 locus=Lus10012558.g ID=Lus10012558.BGIv1.0 annot-version=v1.0 MAGGAFWGTRVMEIVKKHDSGGLVWKRIKLTPSRKANAKKRLLRVWQNEAVLRACAEPPPSTTSANEAAAVGEGDADANNNTNSYSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27435			unknown protein		Lus10012558 [exp]	0	1
AT2G25720			unknown protein		Lus10032479 [exp]	3.9	0.7508
AT1G27050	HD	ATHB54	homeobox protein 54 (.1)		Lus10036708 [exp]	8.7	0.7441
AT5G48385			FRIGIDA-like protein (.1)		Lus10004131 [exp]	9.9	0.7037
AT5G17510			unknown protein		Lus10024979 [exp]	17.0	0.6987
AT3G47620	TCP	AtTCP14, TCP14	"TEOSINTE BRANCHED, cycloidea ...		Lus10013814 [exp]	17.2	0.7250
AT5G27690			Heavy metal transport/detoxifi...		Lus10015174 [exp]	21.6	0.7327
AT4G10810			unknown protein		Lus10022380 [exp]	24.7	0.6619
AT1G74900		OTP43	organelle transcript processin...		Lus10042307 [exp]	28.3	0.6961
AT5G27990			Pre-rRNA-processing protein TS...		Lus10006795 [exp]	28.9	0.7192
AT5G27690			Heavy metal transport/detoxifi...		Lus10031495 [exp]	30.7	0.7316

Compare expression of checked genes

Lus10012558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.