Lus10012561 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013471 87 / 9e-23 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G119200 48 / 8e-08 AT2G47485 57 / 3e-11 unknown protein
PFAM info
Representative CDS sequence
>Lus10012561 pacid=23143806 polypeptide=Lus10012561 locus=Lus10012561.g ID=Lus10012561.BGIv1.0 annot-version=v1.0
ATGAACCGGGGAGGCTCCCATCTCCTACGTGGCACCAACCAGGTGAGACGGAAGCTGAAGATCGTCCGGCTGGGAGGCAGAGGAAGAGGTGTACGGAAGT
TCATAAAGGCAGTAAAGAAGTGTTGGAGCCAGAACAGTACCGTTGTTGATGCTCCGTTGAAGATGCTGGCTCGTTTCCACGAGGGTTACGTGCGAGTGAT
GGTGAAAGTGGCGGGGGGATTTCATTGGAAGGTGGTCGGCGCCGGAGACGGTCGGATATGGGAGCTGCCGTGTGGAGACAAAGTCGATGACAGAGCGCTT
CCTGAGCTGTATAGTAAGCTTCTGGCTTCTCATTCAAGAATGAGCATTGGGTGGTGTTAA
AA sequence
>Lus10012561 pacid=23143806 polypeptide=Lus10012561 locus=Lus10012561.g ID=Lus10012561.BGIv1.0 annot-version=v1.0
MNRGGSHLLRGTNQVRRKLKIVRLGGRGRGVRKFIKAVKKCWSQNSTVVDAPLKMLARFHEGYVRVMVKVAGGFHWKVVGAGDGRIWELPCGDKVDDRAL
PELYSKLLASHSRMSIGWC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012561 0 1
AT3G06830 Plant invertase/pectin methyle... Lus10000034 5.1 0.6903
AT3G47440 TIP5;1 tonoplast intrinsic protein 5;... Lus10031157 37.1 0.6509
Lus10041547 50.0 0.6200
AT5G20690 Leucine-rich repeat protein ki... Lus10013165 64.7 0.6190
AT3G07610 IBM1 increase in bonsai methylation... Lus10004549 91.0 0.5998
AT3G11770 Polynucleotidyl transferase, r... Lus10036491 134.1 0.5365
Lus10021816 153.0 0.5616
AT2G36540 Haloacid dehalogenase-like hyd... Lus10019760 209.8 0.5385
AT2G29490 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, ... Lus10007896 221.1 0.5357

Lus10012561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.