Lus10012565 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14030 205 / 1e-67 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041525 267 / 3e-90 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10031996 252 / 4e-86 AT5G14030 263 / 1e-90 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10035166 250 / 2e-85 AT5G14030 264 / 7e-91 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G061900 226 / 1e-75 AT5G14030 210 / 6e-69 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Potri.001G323400 217 / 3e-72 AT5G14030 215 / 2e-71 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0159 E-set PF05753 TRAP_beta Translocon-associated protein beta (TRAPB)
Representative CDS sequence
>Lus10012565 pacid=23143811 polypeptide=Lus10012565 locus=Lus10012565.g ID=Lus10012565.BGIv1.0 annot-version=v1.0
ATGGCGATCTCAGTCCCCAAGCCTTTGATCTCATTGCTGTTGGCTCTGCTGTACGTCTCGTCCGCGCTAGGTGCCTCCGATGTTCCTTTCATCGTGGCTC
ACAAGAAGGCAACGCTCAACCGTCTCAAATCGGGAGCCGAACGTGTCTCCGTTTCCATCGATATCTACAATCAAGGAACCTCGACAGTATATGATGTGAG
TCTTGTTGATGATCACTGGCCCAAAGATAAGTTCGATGTTGTGAGTGGTAACATATCACAATCATGGGAAAGATTAGACGCGGGTGGTCTACTGTCACTG
GCTTTCGAACTTGAGGGAAAAGTGAAGGGCATGTTCTACAGCGCCCCTGCTGTTATTACATTCCGTGTCCCTACCAAGGCTGCTTTGCAGGAGGCATTTT
CAACTCCAATCCTCCCCCTTGATATTCTGGCAGAGAGAGTTGCTGAGAATAAGCTTGACTTGAGGCTGTTGGCGAAATATGGATCGTTAGTGTCAGTCAT
TTCTATTGTGGTTCTATTTGTTCACCTTGTGAGCTCTCCAACATCCAAATCTGCTGCTGCGAAGAAGAAACGTTAA
AA sequence
>Lus10012565 pacid=23143811 polypeptide=Lus10012565 locus=Lus10012565.g ID=Lus10012565.BGIv1.0 annot-version=v1.0
MAISVPKPLISLLLALLYVSSALGASDVPFIVAHKKATLNRLKSGAERVSVSIDIYNQGTSTVYDVSLVDDHWPKDKFDVVSGNISQSWERLDAGGLLSL
AFELEGKVKGMFYSAPAVITFRVPTKAALQEAFSTPILPLDILAERVAENKLDLRLLAKYGSLVSVISIVVLFVHLVSSPTSKSAAAKKKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14030 translocon-associated protein ... Lus10012565 0 1
AT1G51980 Insulinase (Peptidase family M... Lus10038262 5.9 0.9393
AT2G16595 Translocon-associated protein ... Lus10007577 13.3 0.9164
AT5G48490 Bifunctional inhibitor/lipid-t... Lus10038233 16.3 0.9187
AT2G47470 ATPDI11, ATPDIL... UNFERTILIZED EMBRYO SAC 5, MAT... Lus10010274 16.5 0.9002
AT1G70770 Protein of unknown function DU... Lus10003709 21.9 0.9144
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Lus10007739 23.4 0.9149
AT5G60640 ATPDI2, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Lus10022581 24.8 0.8940
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10024626 28.1 0.9147
AT3G19850 Phototropic-responsive NPH3 fa... Lus10012901 28.6 0.9148
Lus10024615 34.5 0.9145

Lus10012565 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.