Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66040 129 / 1e-39 STR16 sulfurtransferase protein 16 (.1.2) AT4G35770 124 / 2e-36 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT5G66170 99 / 4e-27 STR18 sulfurtransferase 18 (.1.2.3) AT2G21045 83 / 8e-21 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G17850 81 / 8e-20 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G27700 71 / 2e-15 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G42220 52 / 2e-08 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G24750 50 / 6e-08 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT3G08920 45 / 5e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT1G17850 40 / 0.0002 Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041525 [exp] 223 / 2e-73 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10005635 [exp] 216 / 1e-72 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2) Lus10028390 [exp] 143 / 2e-44 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041843 [exp] 140 / 5e-43 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10021227 [exp] 134 / 5e-41 AT5G66040 73 / 4e-17 sulfurtransferase protein 16 (.1.2) Lus10041894 [exp] 85 / 1e-21 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3) Lus10041895 [exp] 85 / 6e-21 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 79 / 1e-18 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10028441 [exp] 62 / 5e-13 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G014900 [exp] 149 / 2e-46 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G106400 [exp] 137 / 3e-41 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G111200 [exp] 105 / 6e-30 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.014G131300 [exp] 94 / 4e-25 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 65 / 2e-13 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 60 / 2e-11 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G100600 [exp] 57 / 2e-10 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G059200 [exp] 51 / 3e-08 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.001G355800 [exp] 45 / 4e-06 AT5G55130 683 / 0.0 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2) Potri.015G086100 [exp] 44 / 2e-05 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00581 [flax] [poplar] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Lus10012566 pacid=23143905 polypeptide=Lus10012566 locus=Lus10012566.g ID=Lus10012566.BGIv1.0 annot-version=v1.0 ATGGCATTTCAAGTCTTGCAAGGGAGAGACATAACAATCGCCAACTTTGGTGCAATAGCTAAAGGACGGACTCAGCCAAGGTCGGTTGCTGTTCGGGCAG CATACCAGCTCCTCGGAAAAGGGCACGTGTATTTAGATGTCAGAACTAGTGAGGAGTTCAATGCAGGTCATCCAACTGGAGCCGTGAACATTCCTTACCT ACTCAACAAAGGAGCTGGTACAGGTATGTCTAACAACCCGAAGTTTCTGGATGAAGTATCATTCAAGTTTGACAGGCAGGAGAAAATCCTAGTTGGATGT CAGAGTGGGATGAGATCACGCATGGCTGCAGCTGATATGAAAACTGCTGGGTTTACAAGCGTGGTTTATGTAGCTGGTGGCTATAACTCATGGGTTCAAA ATGGACTACCCACGACAACTAAAAAACCTACTGCCTATTTGTAA
AA sequence Show only first row Show all	>Lus10012566 pacid=23143905 polypeptide=Lus10012566 locus=Lus10012566.g ID=Lus10012566.BGIv1.0 annot-version=v1.0 MAFQVLQGRDITIANFGAIAKGRTQPRSVAVRAAYQLLGKGHVYLDVRTSEEFNAGHPTGAVNIPYLLNKGAGTGMSNNPKFLDEVSFKFDRQEKILVGC QSGMRSRMAAADMKTAGFTSVVYVAGGYNSWVQNGLPTTTKKPTAYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66040		STR16	sulfurtransferase protein 16 (...		Lus10012566 [exp]	0	1
AT2G21150		XCT	XAP5 CIRCADIAN TIMEKEEPER, XAP...		Lus10012170 [exp]	2.6	0.9248
AT1G55325		MAB2, GCT	MACCHI-BOU 2, GRAND CENTRAL, R...		Lus10035972 [exp]	3.2	0.8933
AT5G13150		ATEXO70C1	exocyst subunit exo70 family p...		Lus10037048 [exp]	8.6	0.9064
AT5G43210			Excinuclease ABC, C subunit, N...		Lus10016370 [exp]	8.9	0.8730
AT3G60510			ATP-dependent caseinolytic (Cl...		Lus10028182 [exp]	10.8	0.9056
AT1G03330			Small nuclear ribonucleoprotei...		Lus10000666 [exp]	12.6	0.8662
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	13.2	0.8996
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10041649 [exp]	13.7	0.8996
AT3G10150		ATPAP16, PAP16	purple acid phosphatase 16 (.1...		Lus10042026 [exp]	14.4	0.8902
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10026341 [exp]	16.2	0.8326

Compare expression of checked genes

Lus10012566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.