Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45140 71 / 2e-15 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041646 [exp] 189 / 5e-57 AT3G45140 939 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10027379 [exp] 120 / 1e-32 AT1G72520 867 / 0.0 Arabidopsis thaliana lipoxygenase 4, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Lus10002547 [exp] 120 / 1e-32 AT3G45140 971 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031238 [exp] 102 / 7e-28 AT3G45140 226 / 1e-68 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031810 [exp] 103 / 1e-26 AT3G45140 959 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031809 [exp] 94 / 2e-23 AT3G45140 753 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031236 [exp] 92 / 2e-22 AT3G45140 805 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10039094 [exp] 84 / 1e-19 AT3G45140 946 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10002545 [exp] 65 / 3e-13 AT3G45140 991 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G046200 [exp] 85 / 2e-20 AT3G45140 979 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015500 [exp] 85 / 3e-20 AT3G45140 975 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.009G022400 [exp] 78 / 9e-18 AT3G45140 1008 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015400 [exp] 73 / 3e-16 AT3G45140 990 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015300 [exp] 55 / 1e-09 AT3G45140 943 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.010G057100 [exp] 40 / 0.0001 AT1G67560 1144 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Potri.008G178000 [exp] 39 / 0.0003 AT1G67560 1155 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00305 [flax] [poplar] Lipoxygenase Lipoxygenase
Representative CDS sequence Show only first row Show all	>Lus10012570 pacid=23143863 polypeptide=Lus10012570 locus=Lus10012570.g ID=Lus10012570.BGIv1.0 annot-version=v1.0 ATGAGGGCCGCTAGTACCTTGATCGGTAACGTGGGCAGCAAGGTGCTGGGGTTCAGTAGCTTCTACGTGCCCCGGGATGAAGAGTTCTCTGAAATTAAGC AGGCAAACTTGTCCGTCAAGAGACTCTTCTCGCTTTTGCATTCCTTGTTGCCCATCCTGGAAACCATTTTTATCGGCCCTGCCCTTGGATTCCCACACTT TACAGCCATCAATAAGATGTTCGGCCAAGGACTCATCTTGCCTCCCATTTCCTCAACCAATCTAAAAGCCGTCATCCCAACTCTTATCAGGAATACCGCT GAAGCAAGTGATGACATATTGCAGTTTGAGATCCCTCCAACAATGGAAAGTGAGTAA
AA sequence Show only first row Show all	>Lus10012570 pacid=23143863 polypeptide=Lus10012570 locus=Lus10012570.g ID=Lus10012570.BGIv1.0 annot-version=v1.0 MRAASTLIGNVGSKVLGFSSFYVPRDEEFSEIKQANLSVKRLFSLLHSLLPILETIFIGPALGFPHFTAINKMFGQGLILPPISSTNLKAVIPTLIRNTA EASDDILQFEIPPTMESE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10012570 [exp]	0	1
AT2G28085			SAUR-like auxin-responsive pro...		Lus10021436 [exp]	1.0	0.9447
AT3G57910			D111/G-patch domain-containing...		Lus10021033 [exp]	1.4	0.8990
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015318 [exp]	4.0	0.8619
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10036746 [exp]	5.0	0.8515
AT4G25480	AP2_ERF	CBF3, DREB1A, A...	C-REPEAT BINDING FACTOR 3, de...		Lus10024491 [exp]	6.5	0.8819
AT1G80760		NLM7, NIP6;1	NOD26-like intrinsic protein 6...		Lus10041674 [exp]	6.9	0.8427
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Lus10026876 [exp]	7.1	0.8345
AT4G25470	AP2_ERF	DREB1C, FTQ4, C...	FREEZING TOLERANCE QTL 4, DRE/...		Lus10017828 [exp]	7.9	0.8421
AT1G14280		PKS2	phytochrome kinase substrate 2...		Lus10037181 [exp]	8.9	0.8172
AT5G52250		EFO1, RUP1	REPRESSOR OF UV-B PHOTOMORPHOG...		Lus10005742 [exp]	9.2	0.8447

Compare expression of checked genes

Lus10012570 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.