Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012594 pacid=23143849 polypeptide=Lus10012594 locus=Lus10012594.g ID=Lus10012594.BGIv1.0 annot-version=v1.0 ATGACAACAACCAGCACACAAATGGAAATCTTGCTACTATTTTCCTCCATTAATTCCCTGCAGCAGAAGGTTGCTTGGCTATTAGGAGATGCACACACAA ATGGAAACATCAGACTTCAGACTCAGATGCAGATTGATCACAGTGATGCTGCTGTCACAGTCCACTTCCCCAGTTGA
AA sequence Show only first row Show all	>Lus10012594 pacid=23143849 polypeptide=Lus10012594 locus=Lus10012594.g ID=Lus10012594.BGIv1.0 annot-version=v1.0 MTTTSTQMEILLLFSSINSLQQKVAWLLGDAHTNGNIRLQTQMQIDHSDAAVTVHFPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012594 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10013729 [exp]	14.3	0.7881
AT2G01060	GARP		myb-like HTH transcriptional r...		Lus10005036 [exp]	25.9	0.7554
					Lus10039165 [exp]	33.5	0.7109
					Lus10018953 [exp]	47.4	0.7303
AT4G38380			MATE efflux family protein (.1...		Lus10014440 [exp]	58.6	0.7401
AT4G16480		ATINT4	inositol transporter 4 (.1)		Lus10017561 [exp]	64.9	0.7429
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10042731 [exp]	76.5	0.7184
AT1G56140			Leucine-rich repeat transmembr...		Lus10010927 [exp]	98.7	0.7471
					Lus10007207 [exp]	100.3	0.7340
AT4G10970			unknown protein		Lus10032393 [exp]	139.5	0.7409

Compare expression of checked genes

Lus10012594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.