Lus10012596 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11260 62 / 2e-11 ATSTP1, STP1 sugar transporter 1 (.1)
AT3G19940 61 / 5e-11 Major facilitator superfamily protein (.1)
AT1G50310 55 / 3e-09 ATSTP9 sugar transporter 9 (.1)
AT5G23270 55 / 5e-09 ATSTP11, STP11 sugar transporter 11 (.1)
AT3G19930 53 / 3e-08 ATSTP4, STP4 sugar transporter 4 (.1)
AT4G21480 52 / 3e-08 STP12 sugar transporter protein 12 (.1)
AT1G77210 47 / 2e-06 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2)
AT5G26250 44 / 3e-05 Major facilitator superfamily protein (.1)
AT4G02050 44 / 3e-05 STP7 sugar transporter protein 7 (.1)
AT1G34580 43 / 6e-05 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012766 74 / 1e-16 AT4G21480 50 / 2e-07 sugar transporter protein 12 (.1)
Lus10040991 63 / 1e-11 AT3G19940 666 / 0.0 Major facilitator superfamily protein (.1)
Lus10013441 57 / 1e-09 AT1G50310 731 / 0.0 sugar transporter 9 (.1)
Lus10040993 57 / 1e-09 AT1G50310 601 / 0.0 sugar transporter 9 (.1)
Lus10018422 56 / 2e-09 AT1G11260 835 / 0.0 sugar transporter 1 (.1)
Lus10002597 56 / 2e-09 AT1G11260 798 / 0.0 sugar transporter 1 (.1)
Lus10042516 55 / 6e-09 AT1G11260 608 / 0.0 sugar transporter 1 (.1)
Lus10022421 47 / 2e-06 AT1G77210 790 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2)
Lus10020934 44 / 2e-05 AT1G34580 664 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G090700 60 / 1e-10 AT3G19940 710 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G073900 58 / 4e-10 AT3G19940 706 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G073850 57 / 7e-10 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G073800 57 / 7e-10 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G072800 56 / 2e-09 AT3G19940 672 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G033600 54 / 7e-09 AT1G11260 822 / 0.0 sugar transporter 1 (.1)
Potri.011G042100 54 / 9e-09 AT1G11260 808 / 0.0 sugar transporter 1 (.1)
Potri.004G110630 52 / 4e-08 AT1G11260 629 / 0.0 sugar transporter 1 (.1)
Potri.004G109765 52 / 6e-08 AT1G11260 630 / 0.0 sugar transporter 1 (.1)
Potri.004G101950 52 / 6e-08 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Lus10012596 pacid=23143812 polypeptide=Lus10012596 locus=Lus10012596.g ID=Lus10012596.BGIv1.0 annot-version=v1.0
ATGGTGATCGGCCATATGCCCATCGTGATGGGCATCTTCATGGCCCACCTAGTCAGCTCTGAGATAATGGACCACTTGGACGAGTGCTCGCGGTGGCGCG
TGCGTCTAGGAGTCGCGTCCGTCCCCGCCATATCCGCCATCGGGTACCATCTCTTATTCAATTTGTCTTTCGGCCTCCCCTTCGCACCAGAAGAAGAAGA
AGAAGAAGATATCAAGGTTGGTGAATCATCAACGAGGGCGGCCAACATCAAGCCACGTGATTACCTAGCGGAGGAGGTGGATGAGGAGCTAGCCGTGCCG
TCGCTAAAGCAAAAAGAGGGACGTGAGCAATCACCGTGGGTCCGTCCTCGTTACTACTATCTAGTGGCGGCATTGACCGTCCCCTTGCTAATGCAGAAGT
TGACTGGTGTCAACCTCGTCGTGATGTTTTATCTTCCGGTGCTTTTCCATGCCATTTTTGTCGGGAGCGATGCCTGCTTGCTTTGCTCCGTCGTCATCAA
CGTGGCATTGGCGCTTGTTTTGCCCATACCGATTTGA
AA sequence
>Lus10012596 pacid=23143812 polypeptide=Lus10012596 locus=Lus10012596.g ID=Lus10012596.BGIv1.0 annot-version=v1.0
MVIGHMPIVMGIFMAHLVSSEIMDHLDECSRWRVRLGVASVPAISAIGYHLLFNLSFGLPFAPEEEEEEDIKVGESSTRAANIKPRDYLAEEVDEELAVP
SLKQKEGREQSPWVRPRYYYLVAALTVPLLMQKLTGVNLVVMFYLPVLFHAIFVGSDACLLCSVVINVALALVLPIPI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Lus10012596 0 1
AT1G07175 unknown protein Lus10018252 4.2 0.7272
Lus10038105 4.5 0.7901
Lus10019810 17.9 0.7158
AT5G24090 ATCHIA chitinase A (.1) Lus10037984 32.5 0.6472
AT3G15280 unknown protein Lus10005404 33.6 0.6636
AT5G54010 UDP-Glycosyltransferase superf... Lus10008453 34.4 0.6633
AT3G19920 unknown protein Lus10010180 36.8 0.6476
Lus10036275 39.2 0.6602
Lus10015230 39.2 0.6783
AT5G12060 Plant self-incompatibility pro... Lus10023195 39.6 0.6610

Lus10012596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.