Lus10012599 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 261 / 3e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 261 / 5e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 245 / 5e-85 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034378 301 / 5e-107 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10035133 289 / 5e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10031970 289 / 5e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10038012 286 / 4e-101 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10009252 286 / 4e-101 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 277 / 1e-97 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 271 / 3e-95 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 270 / 8e-95 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10012599 pacid=23143903 polypeptide=Lus10012599 locus=Lus10012599.g ID=Lus10012599.BGIv1.0 annot-version=v1.0
ATGGCGACAGCAGCAGCTGCTTCCCCAATCGAGTCCGTCCAGTGCTTCGGCCGCAAGAAGACTGCGGTCGCCGTCACTCACTGCAAGCGCGGAAGGGGCC
TCATCAAGCTCAATGGAACCCCCATCGAGCTCGTGGAGCCTGAGATCCTCCGTTTCAAGGCCGTCGAACCCATTCTCATACTAGGCCGTCACCGTTTCAG
CGGCGTGGATATGCGCATCCGAGTCAAAGGAGGCGGACACACCTCTCAGATCTACGCCATCCGTCAGAGCATCGCCAAGGCACTCGTCGCTTTCTACCAG
AAGTACGTCGACGAGCAGAGCAAGAAGGAGATCAAGGACCTCTTGGTCAGCTACGACAGGACTTTGCTCGTCGCTGATCCCAGACGTTGCGAGCCTAAGA
AGTTCGGTGGCCGTGGTGCTCGTTCCAGATTCCAGAAGAGTTACCGTTGA
AA sequence
>Lus10012599 pacid=23143903 polypeptide=Lus10012599 locus=Lus10012599.g ID=Lus10012599.BGIv1.0 annot-version=v1.0
MATAAAASPIESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELVEPEILRFKAVEPILILGRHRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQ
KYVDEQSKKEIKDLLVSYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18380 Ribosomal protein S5 domain 2-... Lus10012599 0 1
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10009578 2.0 0.9084
AT3G44620 protein tyrosine phosphatases;... Lus10019533 3.5 0.8750
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10013381 3.7 0.9031
AT5G48760 Ribosomal protein L13 family p... Lus10022793 4.2 0.8814
AT1G80560 ATIMD2 ARABIDOPSIS ISOPROPYLMALATE DE... Lus10030344 5.0 0.8751
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10005348 6.5 0.8747
AT1G48830 Ribosomal protein S7e family p... Lus10017497 6.6 0.8762
AT1G50920 Nucleolar GTP-binding protein ... Lus10027370 6.9 0.8496
AT1G16790 ribosomal protein-related (.1) Lus10034801 7.2 0.8313
AT2G31610 Ribosomal protein S3 family pr... Lus10033442 8.5 0.8665

Lus10012599 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.