Lus10012612 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01180 181 / 3e-58 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010109 214 / 4e-71 AT1G01180 397 / 1e-139 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10013195 149 / 2e-45 AT1G01180 353 / 2e-122 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10030709 148 / 3e-45 AT1G01180 350 / 3e-121 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G177500 196 / 4e-64 AT1G01180 383 / 4e-134 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.014G103800 192 / 7e-63 AT1G01180 373 / 2e-130 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10012612 pacid=23161343 polypeptide=Lus10012612 locus=Lus10012612.g ID=Lus10012612.BGIv1.0 annot-version=v1.0
ATGCAGAACGCGGCGTACAGCAACTCGACCGGGTCGGTTCTGCCCGTGCCGTTCTCGTCCGGGTCGGCGCTGCAGAAGCTGTGTGAGTGGAGGGTGTACG
GGGATTTGATAAAGATCGATGCTGGTCATGATTTTAACTCGGCTTGGGCGGATATAAACCGGGCGTACCGGATATTGAGACCCGGTGGAGTCATATTCGG
GCATGATTATTTTACGGTGGCGGATAATAGGGGTGTGAGAAGGGCGGTAAATCTGTTTGCACAAATGAATGGGCTGAAAGTGAGAGCTGATAGTCAACAT
TGGGTCATTGACTCTTAG
AA sequence
>Lus10012612 pacid=23161343 polypeptide=Lus10012612 locus=Lus10012612.g ID=Lus10012612.BGIv1.0 annot-version=v1.0
MQNAAYSNSTGSVLPVPFSSGSALQKLCEWRVYGDLIKIDAGHDFNSAWADINRAYRILRPGGVIFGHDYFTVADNRGVRRAVNLFAQMNGLKVRADSQH
WVIDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01180 S-adenosyl-L-methionine-depend... Lus10012612 0 1
AT1G29450 SAUR-like auxin-responsive pro... Lus10007057 1.4 0.6787
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 29.1 0.6120
AT2G26490 Transducin/WD40 repeat-like su... Lus10032868 30.0 0.6120
AT2G24370 Protein kinase protein with ad... Lus10027593 30.9 0.6120
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 31.7 0.6120
AT3G08030 Protein of unknown function, D... Lus10029502 32.6 0.6120
AT1G30700 FAD-binding Berberine family p... Lus10031080 33.4 0.6120
Lus10039674 34.1 0.6120
Lus10021739 34.9 0.6120
Lus10004437 35.7 0.6120

Lus10012612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.