Plant FIBer expression Database

Lus10012620 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10810 63 / 8e-15 unknown protein
AT4G24026 54 / 3e-11 unknown protein
AT4G24030 53 / 2e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010114
[exp]
108 / 1e-30 AT4G10810 63 / 5e-13 unknown protein
Lus10007785
[exp]
49 / 2e-08 ND 56 / 4e-11
Lus10022380
[exp]
43 / 6e-07 AT4G10810 60 / 2e-13 unknown protein
Lus10023038
[exp]
41 / 5e-06 AT4G10810 67 / 3e-16 unknown protein
Lus10032433
[exp]
38 / 0.0003 ND 50 / 6e-08
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G173700
[exp]
71 / 9e-18 AT4G10810 69 / 8e-17 unknown protein
Potri.014G013600
[exp]
56 / 8e-12 AT4G10810 56 / 1e-11 unknown protein
Potri.002G116200
[exp]
53 / 1e-10 AT4G10810 53 / 3e-10 unknown protein
Potri.014G007000
[exp]
50 / 3e-09 AT4G10810 43 / 1e-06 unknown protein
Potri.001G087200
[exp]
46 / 3e-08 AT4G10810 60 / 2e-13 unknown protein
Potri.003G143800
[exp]
43 / 7e-07 AT4G10810 60 / 2e-13 unknown protein
PFAM info
Representative CDS sequence
>Lus10012620 pacid=23161359 polypeptide=Lus10012620 locus=Lus10012620.g ID=Lus10012620.BGIv1.0 annot-version=v1.0
ATGGCGTGCGGGAAATTGGATAGAGCGGCGAGCTGGGTGGGGGAGAACGTGGCCTCTGCCTTCTTCGCATCCCTTGAGCGTTGCTCCTGCATCAACCTCA
GCACCTCCGATGATAACAGGACCGACGCCCCAGACCTGCCCCTCGGCCTCCCCGCCTCTTCCTTCTCCTCCGCCACCGAACCCGTCGCTCCTGCCTCCGC
TGTCGCCAGCAGCTCGGATGCTAATATCAAGTGA
AA sequence
>Lus10012620 pacid=23161359 polypeptide=Lus10012620 locus=Lus10012620.g ID=Lus10012620.BGIv1.0 annot-version=v1.0
MACGKLDRAASWVGENVASAFFASLERCSCINLSTSDDNRTDAPDLPLGLPASSFSSATEPVAPASAVASSSDANIK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10810 unknown protein Lus10012620
[exp]
0 1
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Lus10034276
[exp]
11.5 0.6811
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10008281
[exp]
16.3 0.7235
AT5G47710 Calcium-dependent lipid-bindin... Lus10039113
[exp]
21.4 0.6740
AT1G70480 Domain of unknown function (DU... Lus10013018
[exp]
21.9 0.7098
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10033247
[exp]
27.5 0.6802
AT3G61610 Galactose mutarotase-like supe... Lus10000254
[exp]
28.6 0.6810
AT5G02800 CDL1 CDG1-like 1, Protein kinase su... Lus10015050
[exp]
43.2 0.6212
AT5G42700 B3 AP2/B3-like transcriptional fa... Lus10032748
[exp]
45.7 0.6654
AT5G14970 unknown protein Lus10014506
[exp]
49.9 0.6390
AT3G63390 unknown protein Lus10018745
[exp]
52.8 0.6204

Lus10012620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.