Lus10012623 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010118 245 / 5e-85 AT1G04520 40 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10028049 208 / 2e-70 AT1G04520 38 / 9e-04 plasmodesmata-located protein 2 (.1)
Lus10003759 176 / 9e-58 ND 38 / 9e-04
Lus10010115 155 / 7e-50 AT5G48540 41 / 5e-05 receptor-like protein kinase-related family protein (.1)
Lus10003758 146 / 6e-45 ND /
Lus10028050 110 / 7e-32 ND 36 / 0.004
Lus10035753 108 / 4e-30 ND /
Lus10008314 105 / 6e-30 ND /
Lus10014738 99 / 2e-27 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 38 / 0.0004 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10012623 pacid=23161362 polypeptide=Lus10012623 locus=Lus10012623.g ID=Lus10012623.BGIv1.0 annot-version=v1.0
ATGCATTCCTCGCCGACATTAGCAGCATATGTAGTCTTGGTTATGGGTCTTATAAGTATGCTCCTCCTCGTGGAGGCCAAACTTCCTAACACCAAAGTCG
TGGTCAAACCTGCTTGCGATGTCGGATATGCGAGCAAGAGATACAACAATTACGCGATCCACTTGTTGGATTTCCTCGTGGACGAAACGAAGAACATGTA
CAAGAATAAGGACGGGAGTTACACATACTGTCACAGCTATCCTGATCTGGATTCGGGGTCGGCCAACGGAGTGGGGAATTGTGGTAGAAAGCTTAAGAAG
TTGGATTGTTGGTCGTGTCTTCGAAATGCTAAGGACAAGCTCAAGTTGGCTTGTCCCAGGGCAGTAGGTGGTAACATCACTCATACAGACTGCTCCATCT
CCTTCAACCGGATTCCTTAA
AA sequence
>Lus10012623 pacid=23161362 polypeptide=Lus10012623 locus=Lus10012623.g ID=Lus10012623.BGIv1.0 annot-version=v1.0
MHSSPTLAAYVVLVMGLISMLLLVEAKLPNTKVVVKPACDVGYASKRYNNYAIHLLDFLVDETKNMYKNKDGSYTYCHSYPDLDSGSANGVGNCGRKLKK
LDCWSCLRNAKDKLKLACPRAVGGNITHTDCSISFNRIP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012623 0 1
Lus10032803 1.0 0.9382
AT3G16180 Major facilitator superfamily ... Lus10009506 6.5 0.8705
Lus10033149 7.9 0.8705
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 9.2 0.8705
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 10.2 0.8705
Lus10042684 11.0 0.7453
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 11.2 0.8705
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 12.1 0.8705
AT1G28270 RALFL4 ralf-like 4 (.1) Lus10005541 12.6 0.6214
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 13.0 0.8705

Lus10012623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.