Lus10012646 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61350 87 / 9e-21 Protein kinase superfamily protein (.1)
AT5G54380 84 / 1e-19 THE1 THESEUS1, protein kinase family protein (.1)
AT2G23200 83 / 3e-19 Protein kinase superfamily protein (.1)
AT4G39110 80 / 3e-18 Malectin/receptor-like protein kinase family protein (.1)
AT2G21480 80 / 4e-18 Malectin/receptor-like protein kinase family protein (.1)
AT1G30570 78 / 2e-17 HERK2 hercules receptor kinase 2 (.1)
AT2G39360 77 / 2e-17 Protein kinase superfamily protein (.1)
AT5G59700 77 / 3e-17 Protein kinase superfamily protein (.1)
AT3G51550 77 / 3e-17 FER FERONIA, Malectin/receptor-like protein kinase family protein (.1)
AT5G38990 77 / 3e-17 Malectin/receptor-like protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012101 169 / 1e-49 AT2G23200 494 / 2e-162 Protein kinase superfamily protein (.1)
Lus10010443 162 / 5e-47 AT2G23200 498 / 6e-164 Protein kinase superfamily protein (.1)
Lus10042844 85 / 8e-20 AT3G46290 1025 / 0.0 hercules receptor kinase 1 (.1)
Lus10028140 85 / 8e-20 AT3G46290 1024 / 0.0 hercules receptor kinase 1 (.1)
Lus10030308 84 / 1e-19 AT3G46290 735 / 0.0 hercules receptor kinase 1 (.1)
Lus10037887 82 / 1e-18 AT5G54380 1279 / 0.0 THESEUS1, protein kinase family protein (.1)
Lus10003312 82 / 1e-18 AT3G46290 741 / 0.0 hercules receptor kinase 1 (.1)
Lus10038595 81 / 1e-18 AT5G54380 718 / 0.0 THESEUS1, protein kinase family protein (.1)
Lus10017478 78 / 1e-17 AT4G39110 1149 / 0.0 Malectin/receptor-like protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G213200 88 / 6e-21 AT3G46290 808 / 0.0 hercules receptor kinase 1 (.1)
Potri.005G143200 84 / 8e-20 AT2G23200 674 / 0.0 Protein kinase superfamily protein (.1)
Potri.011G128000 84 / 1e-19 AT5G54380 1231 / 0.0 THESEUS1, protein kinase family protein (.1)
Potri.001G405500 84 / 1e-19 AT5G54380 1232 / 0.0 THESEUS1, protein kinase family protein (.1)
Potri.005G143700 83 / 2e-19 AT5G24010 566 / 0.0 Protein kinase superfamily protein (.1)
Potri.005G144100 82 / 4e-19 AT5G24010 550 / 0.0 Protein kinase superfamily protein (.1)
Potri.001G234200 81 / 2e-18 AT3G46290 1106 / 0.0 hercules receptor kinase 1 (.1)
Potri.017G096400 79 / 4e-18 AT3G51550 451 / 6e-151 FERONIA, Malectin/receptor-like protein kinase family protein (.1)
Potri.017G096000 79 / 6e-18 AT3G51550 832 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1)
Potri.017G096600 79 / 6e-18 AT3G51550 829 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10012646 pacid=23161369 polypeptide=Lus10012646 locus=Lus10012646.g ID=Lus10012646.BGIv1.0 annot-version=v1.0
ATGAAGAAGAATTCGTCTGATTCTGTGAAGCAATCGAAATCGAAATATTCAACCTCCGCCAGTGCTGGGAAGAAGTTGCACAGCTGGATGGCGGTGAATA
ATACCACTAGCCATGGCTCGCCTTGCCCCGAGCTGAATCTAAAGCTCAAGATGCCATTAGCTGAAATCATGGCTGCAACAGAGAAGCGAAGAATCGTGTC
ACATGTAAGGTCTACCCGAATTCCAGATAGAGGTTCTAGTCCTCGCCATAGACATCTAGTCTCCTTGATCGGCTACTGCGATGACAGAGCTGAGATGATT
CTCGTTTACGAGTTCATGAAGAACGAAACTCTCAGGGAATATCTCTACACCTCGGAACACGATCCTCCTCCGCCATTATTGAGCTGGAAGCAAAGGCTTG
AGATCTACATAGGATAG
AA sequence
>Lus10012646 pacid=23161369 polypeptide=Lus10012646 locus=Lus10012646.g ID=Lus10012646.BGIv1.0 annot-version=v1.0
MKKNSSDSVKQSKSKYSTSASAGKKLHSWMAVNNTTSHGSPCPELNLKLKMPLAEIMAATEKRRIVSHVRSTRIPDRGSSPRHRHLVSLIGYCDDRAEMI
LVYEFMKNETLREYLYTSEHDPPPPLLSWKQRLEIYIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G23200 Protein kinase superfamily pro... Lus10012646 0 1
AT5G01300 PEBP (phosphatidylethanolamine... Lus10002212 5.7 0.8946
Lus10039892 8.1 0.9128
AT3G57120 Protein kinase superfamily pro... Lus10011517 8.8 0.8497
Lus10032841 10.9 0.9015
AT3G08890 Protein of unknown function, D... Lus10012498 16.2 0.8905
AT3G15270 SBP SPL5 squamosa promoter binding prot... Lus10005548 18.3 0.8729
AT5G66740 Protein of unknown function (D... Lus10026031 26.2 0.8475
AT1G16260 Wall-associated kinase family ... Lus10009751 26.9 0.7620
AT5G24230 Lipase class 3-related protein... Lus10018097 27.4 0.7563
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 27.7 0.8440

Lus10012646 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.