Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18650 47 / 1e-07 MADS AGL103 AGAMOUS-like 103 (.1) AT5G40120 47 / 1e-07 MADS AGL76 AGAMOUS-like 76 (.1) AT4G02235 46 / 2e-07 MADS AGL51 AGAMOUS-like 51 (.1) AT5G38740 46 / 2e-07 MADS AGL77 AGAMOUS-like 77 (.1) AT5G65330 46 / 3e-07 MADS AGL78 AGAMOUS-like 78 (.1) AT5G40220 45 / 4e-07 MADS AGL43 AGAMOUS-like 43 (.1) AT5G41200 45 / 6e-07 MADS AGL75 AGAMOUS-like 75 (.1) AT5G39810 44 / 9e-07 MADS AGL98 AGAMOUS-like 98 (.1) AT4G11250 44 / 1e-06 MADS AGL52 AGAMOUS-like 52 (.1) AT5G39750 44 / 2e-06 MADS AGL81, EMB3008 EMBRYO DEFECTIVE 3008, AGAMOUS-like 81 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024347 [exp] 100 / 2e-28 AT3G18650 63 / 8e-12 AGAMOUS-like 103 (.1) Lus10021494 [exp] 82 / 3e-21 AT3G18650 65 / 8e-13 AGAMOUS-like 103 (.1) Lus10022594 [exp] 78 / 5e-20 AT3G18650 61 / 2e-11 AGAMOUS-like 103 (.1) Lus10024823 [exp] 37 / 0.0003 AT1G22130 142 / 3e-40 AGAMOUS-like 104 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G222200 [exp] 46 / 2e-07 AT5G41200 65 / 5e-12 AGAMOUS-like 75 (.1) Potri.010G238900 [exp] 43 / 3e-06 AT3G18650 66 / 1e-12 AGAMOUS-like 103 (.1) Potri.007G120002 [exp] 40 / 1e-05 AT1G77980 97 / 1e-25 AGAMOUS-like 66 (.1) Potri.015G077800 [exp] 40 / 3e-05 AT4G02235 45 / 7e-06 AGAMOUS-like 51 (.1) Potri.008G020300 [exp] 37 / 0.0004 AT3G18650 75 / 3e-15 AGAMOUS-like 103 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10012656 pacid=23156090 polypeptide=Lus10012656 locus=Lus10012656.g ID=Lus10012656.BGIv1.0 annot-version=v1.0 ATGTCTCGGTCACCACAACTGAAGAAGACGAGAAGAACCCTCAAGAAGAAAGCGCCGGAGCTCTCTACTCTCTGCTGCATCGACGTCGCCTACGTTTGCT TCGAACCCAACGGCGAAGTCGATACGTGGTCGGAGGATCCAAACAAGGTCAAAGACATCATTCTCAAGTACAGGCATGTCAAATCTGCTATAAAGTATCC TCTTAAACTTGTTCCGACGTAA
AA sequence Show only first row Show all	>Lus10012656 pacid=23156090 polypeptide=Lus10012656 locus=Lus10012656.g ID=Lus10012656.BGIv1.0 annot-version=v1.0 MSRSPQLKKTRRTLKKKAPELSTLCCIDVAYVCFEPNGEVDTWSEDPNKVKDIILKYRHVKSAIKYPLKLVPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18650	MADS	AGL103	AGAMOUS-like 103 (.1)		Lus10012656 [exp]	0	1
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014688 [exp]	8.9	0.8874
AT2G18700		ATTPSB, ATTPS11	TREHALOSE-6-PHOSPHATE SYNTHASE...		Lus10015509 [exp]	9.4	0.8982
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Lus10016884 [exp]	11.0	0.8963
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10042933 [exp]	15.0	0.8845
AT1G56290			CwfJ-like family protein (.1)		Lus10021219 [exp]	23.8	0.8943
AT4G17770		ATTPS5	TREHALOSE -6-PHOSPHATASE SYNTH...		Lus10019982 [exp]	24.5	0.8584
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10020070 [exp]	25.7	0.8735
AT1G08710			F-box family protein (.1.2)		Lus10009519 [exp]	29.9	0.8661
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10030901 [exp]	31.3	0.8861
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Lus10037750 [exp]	31.7	0.8826

Compare expression of checked genes

Lus10012656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.