Lus10012659 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34300 147 / 1e-41 lectin protein kinase family protein (.1)
AT5G24080 141 / 2e-40 Protein kinase superfamily protein (.1)
AT5G35370 141 / 1e-39 S-locus lectin protein kinase family protein (.1)
AT4G00340 138 / 2e-38 RLK4 receptor-like protein kinase 4 (.1)
AT2G19130 137 / 5e-38 S-locus lectin protein kinase family protein (.1)
AT4G32300 136 / 7e-38 SD2-5 S-domain-2 5 (.1)
AT5G60900 122 / 7e-33 RLK1 receptor-like protein kinase 1 (.1)
AT5G48940 120 / 3e-32 Leucine-rich repeat transmembrane protein kinase family protein (.1)
AT1G66910 119 / 6e-32 Protein kinase superfamily protein (.1)
AT4G32710 117 / 6e-32 PERK14 proline-rich extensin-like receptor kinase 14, Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024348 245 / 4e-77 AT2G19130 378 / 4e-118 S-locus lectin protein kinase family protein (.1)
Lus10024343 238 / 5e-74 AT2G19130 379 / 6e-117 S-locus lectin protein kinase family protein (.1)
Lus10032944 228 / 1e-70 AT2G19130 371 / 1e-115 S-locus lectin protein kinase family protein (.1)
Lus10013252 149 / 3e-42 AT1G34300 378 / 7e-119 lectin protein kinase family protein (.1)
Lus10004283 137 / 6e-38 AT2G19130 339 / 6e-104 S-locus lectin protein kinase family protein (.1)
Lus10039732 136 / 1e-37 AT2G19130 647 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10031596 135 / 2e-37 AT2G19130 749 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10033748 134 / 4e-37 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10043391 134 / 6e-37 AT4G32300 795 / 0.0 S-domain-2 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G102500 199 / 2e-60 AT1G34300 360 / 1e-111 lectin protein kinase family protein (.1)
Potri.016G102600 199 / 3e-60 AT1G34300 367 / 1e-114 lectin protein kinase family protein (.1)
Potri.016G102700 197 / 1e-59 AT1G34300 356 / 5e-110 lectin protein kinase family protein (.1)
Potri.016G102900 197 / 1e-59 AT1G34300 359 / 2e-111 lectin protein kinase family protein (.1)
Potri.006G091400 193 / 4e-58 AT1G34300 372 / 3e-116 lectin protein kinase family protein (.1)
Potri.013G096300 157 / 2e-47 AT1G34300 262 / 2e-80 lectin protein kinase family protein (.1)
Potri.013G086100 159 / 8e-46 AT4G00340 300 / 1e-89 receptor-like protein kinase 4 (.1)
Potri.013G096000 155 / 8e-45 AT2G19130 300 / 1e-90 S-locus lectin protein kinase family protein (.1)
Potri.013G095800 155 / 1e-44 AT2G19130 350 / 2e-108 S-locus lectin protein kinase family protein (.1)
Potri.013G096400 155 / 2e-44 AT2G19130 347 / 2e-107 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10012659 pacid=23156077 polypeptide=Lus10012659 locus=Lus10012659.g ID=Lus10012659.BGIv1.0 annot-version=v1.0
ATGTTCTGGGCAGAGGTTACCACGATCGGGAAGATCAACCATATGAACCTGGTGAGAATATGGGGGTTCTGTTCCGATAACAGGCATATGATGTCGGTGT
ATGAGTATCTGAAGCACCAATCACTAGATAATTATCTTTTCTCAAGCAGTGGGACAACCTCTCTCGAGTGGGAAGTAAGGTTCAAGGTTGCTTTGGGGAC
GGTGAAAGGATTGGCTTATCTTCACCACGAGTGCCTCGAATGGATCATACATTGCGATGTGAAGCCCAGGAACATACTCTTGGATGACGACTTTGAGCCA
AACATTGTTGATTTCGGGCTCGCAAAGTTGTCGCAGAGGAACAACAACAACTCTCAGTTCACCAAGATCAGAGGGACAAAAAGGGTACATGGCTCCAGAG
TGGGCTTCAAATCTCCCCATTACAGCGAAGGTCGGCGTGTACAACTATGGAGTTGTGATTCTTGA
AA sequence
>Lus10012659 pacid=23156077 polypeptide=Lus10012659 locus=Lus10012659.g ID=Lus10012659.BGIv1.0 annot-version=v1.0
MFWAEVTTIGKINHMNLVRIWGFCSDNRHMMSVYEYLKHQSLDNYLFSSSGTTSLEWEVRFKVALGTVKGLAYLHHECLEWIIHCDVKPRNILLDDDFEP
NIVDFGLAKLSQRNNNNSQFTKIRGTKRVHGSRVGFKSPHYSEGRRVQLWSCDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G34300 lectin protein kinase family p... Lus10012659 0 1
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10037585 5.4 0.9539
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10024511 13.9 0.9441
Lus10027376 16.5 0.9508
AT2G23770 protein kinase family protein ... Lus10019661 20.9 0.9496
Lus10027915 21.6 0.9407
AT1G14185 Glucose-methanol-choline (GMC)... Lus10030462 22.4 0.9383
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10012609 22.6 0.9325
AT5G38210 Protein kinase family protein ... Lus10028495 23.7 0.9501
AT5G06860 ATPGIP1, PGIP1 polygalacturonase inhibiting p... Lus10021028 27.6 0.9458
Lus10031841 29.1 0.9447

Lus10012659 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.