Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53950 113 / 5e-31 glyoxal oxidase-related protein (.1) AT1G67290 49 / 3e-08 GLOX1 glyoxal oxidase 1, glyoxal oxidase-related protein (.1) AT5G19580 49 / 3e-08 glyoxal oxidase-related protein (.1) AT1G75620 41 / 2e-05 glyoxal oxidase-related protein (.1) AT1G19900 37 / 0.0007 glyoxal oxidase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024342 [exp] 142 / 2e-41 AT3G53950 841 / 0.0 glyoxal oxidase-related protein (.1) Lus10011110 [exp] 45 / 8e-07 AT5G19580 597 / 0.0 glyoxal oxidase-related protein (.1) Lus10043231 [exp] 44 / 2e-06 AT5G19580 647 / 0.0 glyoxal oxidase-related protein (.1) Lus10012979 [exp] 44 / 3e-06 AT5G19580 619 / 0.0 glyoxal oxidase-related protein (.1) Lus10034959 [exp] 42 / 8e-06 AT1G67290 619 / 0.0 glyoxal oxidase 1, glyoxal oxidase-related protein (.1) Lus10012980 [exp] 41 / 2e-05 AT1G67290 232 / 5e-73 glyoxal oxidase 1, glyoxal oxidase-related protein (.1) Lus10043230 [exp] 40 / 8e-05 AT5G19580 620 / 0.0 glyoxal oxidase-related protein (.1) Lus10011111 [exp] 40 / 9e-05 AT5G19580 655 / 0.0 glyoxal oxidase-related protein (.1) Lus10030798 [exp] 39 / 0.0001 AT1G14430 623 / 0.0 glyoxal oxidase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G103400 [exp] 130 / 2e-37 AT3G53950 801 / 0.0 glyoxal oxidase-related protein (.1) Potri.005G047701 [exp] 48 / 6e-08 AT3G57620 677 / 0.0 glyoxal oxidase-related protein (.1) Potri.006G160800 [exp] 47 / 1e-07 AT5G19580 668 / 0.0 glyoxal oxidase-related protein (.1) Potri.013G034900 [exp] 46 / 4e-07 AT3G57620 670 / 0.0 glyoxal oxidase-related protein (.1) Potri.018G084200 [exp] 43 / 6e-06 AT5G19580 655 / 0.0 glyoxal oxidase-related protein (.1) Potri.002G027000 [exp] 40 / 3e-05 AT1G75620 708 / 0.0 glyoxal oxidase-related protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF09118 [flax] [poplar] DUF1929 Domain of unknown function (DUF1929)
Representative CDS sequence Show only first row Show all	>Lus10012661 pacid=23156080 polypeptide=Lus10012661 locus=Lus10012661.g ID=Lus10012661.BGIv1.0 annot-version=v1.0 ATGGAGATGCGAATCGAAGCCTTTTCCCCGAAGTATTTGGCACCGGAGAGGGTAAATTTGAAGCCGGTGATCGAGGAAATCCCTGAGACGATTCGTTACG AAGAGGCTTTCATAGTTTCGGTGTCGCTCGAATTGCCGATGGTGGGAATTTTAGAGGTGAACATGGCGAGTGTTCCGTTTGCGACTCACTCGTTGTCGCA GGGGAAGAGATTGGTGAAGTTGACGGTGACGCCTAGCATCCCTGACAAGGGTGGGGGGGTATAA
AA sequence Show only first row Show all	>Lus10012661 pacid=23156080 polypeptide=Lus10012661 locus=Lus10012661.g ID=Lus10012661.BGIv1.0 annot-version=v1.0 MEMRIEAFSPKYLAPERVNLKPVIEEIPETIRYEEAFIVSVSLELPMVGILEVNMASVPFATHSLSQGKRLVKLTVTPSIPDKGGGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53950			glyoxal oxidase-related protei...		Lus10012661 [exp]	0	1

Compare expression of checked genes

Lus10012661 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.