Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033534 [exp] 140 / 6e-44 ND / Lus10020834 [exp] 66 / 1e-14 AT1G70520 46 / 3e-06 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1) Lus10012677 [exp] 60 / 3e-12 ND / Lus10020833 [exp] 59 / 6e-12 AT4G23260 47 / 1e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2) Lus10013257 [exp] 38 / 0.0003 AT4G23300 51 / 3e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10012676 pacid=23148214 polypeptide=Lus10012676 locus=Lus10012676.g ID=Lus10012676.BGIv1.0 annot-version=v1.0 ATGACCAAACTCAGTTCTTGGTGCCCTCAGTACCCAATGCGATCGGACAGAATGACCGTTGCTGCACGCCATGCTTTACAGTATGCGATCGATCAATACG AAGGGCGGCCGGGGGAGCTCCCCAGCTGCGTCACGGACACGTATACTCCCTACACCGTCACTGCCTCTGCTCGATGTACCAACGACAACCTAACTTCCGG ACAGTGCAAGTTCTGTTTATCTAACGCTCAGTCTTGGCTCATTGATAAAGAGTGCCCCTACGCATTCGGAGGTCAACTTATAGTCCAGGACTGTTACTTG ACATATGTCAACGCCAATCAATTTTGTACCTCGTGA
AA sequence Show only first row Show all	>Lus10012676 pacid=23148214 polypeptide=Lus10012676 locus=Lus10012676.g ID=Lus10012676.BGIv1.0 annot-version=v1.0 MTKLSSWCPQYPMRSDRMTVAARHALQYAIDQYEGRPGELPSCVTDTYTPYTVTASARCTNDNLTSGQCKFCLSNAQSWLIDKECPYAFGGQLIVQDCYL TYVNANQFCTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012676 [exp]	0	1
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004042 [exp]	5.0	0.9644
					Lus10022805 [exp]	7.1	0.9644
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	8.7	0.9644
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	10.0	0.9644
AT2G25010			Aminotransferase-like, plant m...		Lus10003764 [exp]	10.4	0.8260
AT5G40250			RING/U-box superfamily protein...		Lus10008797 [exp]	10.5	0.8260
					Lus10011962 [exp]	11.2	0.9644
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10012601 [exp]	12.2	0.9644
AT5G04350			Plant self-incompatibility pro...		Lus10029388 [exp]	13.2	0.9644
					Lus10030558 [exp]	14.1	0.9644

Compare expression of checked genes

Lus10012676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.