Lus10012679 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
AT1G50720 87 / 2e-22 Stigma-specific Stig1 family protein (.1)
AT4G26880 69 / 3e-15 Stigma-specific Stig1 family protein (.1)
AT5G55110 66 / 3e-14 Stigma-specific Stig1 family protein (.1)
AT1G53130 66 / 7e-14 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 58 / 7e-11 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020831 300 / 3e-106 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10043047 71 / 7e-16 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10011146 67 / 3e-14 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10011117 63 / 1e-12 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10000696 62 / 3e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10006512 60 / 7e-12 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10041930 57 / 7e-11 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10005544 51 / 5e-09 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G228100 119 / 9e-35 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 118 / 2e-34 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 117 / 6e-34 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 117 / 2e-33 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 114 / 8e-33 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 113 / 2e-32 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 111 / 7e-32 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.011G008804 103 / 1e-28 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1)
Potri.011G009000 102 / 3e-28 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 101 / 6e-28 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10012679 pacid=23148234 polypeptide=Lus10012679 locus=Lus10012679.g ID=Lus10012679.BGIv1.0 annot-version=v1.0
ATGAAGAACTTGACGATGCTCTTTACTCTTGTGACGTCGATGGCCGTACTAATCCTGACCACCAACGTTACACCAACAACATCCCAAGCAGAAGCAAACC
AACCACTCTTGGTCGGCGACGGCACCGGTAGCCGCTTCCTTCTTGATCAGAAAACATCCTTTTCTGTGGCGGCGGCAGGGGACAACTGGCGGCGGCGCAA
GTGTGACAAGTTCCCGACCACATGCTACCTGAGAGGGAGTCCGGGCCCGCATTGCTGTAACAGGAAGTGCGTGGACGTGGCTAAGGATCGAGCCAACTGC
GGCAAGTGCGGGAGGAGGTGCGGGTACAGCGAGATATGCTGCGGCGGGAAGTGCGTCAACCCGTCGTTTAACCGGTCGAATTGTGGCGGGTGTGGGAACA
AGTGCGATGCTCCTATTGTCGGGGGTCGCAAAAAGCGGGCTTTCTGTGCGTTCGGTCTGTGCAACTATGCGTAG
AA sequence
>Lus10012679 pacid=23148234 polypeptide=Lus10012679 locus=Lus10012679.g ID=Lus10012679.BGIv1.0 annot-version=v1.0
MKNLTMLFTLVTSMAVLILTTNVTPTTSQAEANQPLLVGDGTGSRFLLDQKTSFSVAAAGDNWRRRKCDKFPTTCYLRGSPGPHCCNRKCVDVAKDRANC
GKCGRRCGYSEICCGGKCVNPSFNRSNCGGCGNKCDAPIVGGRKKRAFCAFGLCNYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11925 Stigma-specific Stig1 family p... Lus10012679 0 1
AT2G28360 SIT4 phosphatase-associated fa... Lus10016089 1.7 0.9348
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Lus10001524 2.2 0.9508
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Lus10003076 2.4 0.9441
AT5G03290 IDH-V isocitrate dehydrogenase V (.1... Lus10013806 17.0 0.9130
AT2G03820 nonsense-mediated mRNA decay N... Lus10025109 17.2 0.9094
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10035255 18.5 0.9222
AT5G49610 F-box family protein (.1) Lus10000860 18.7 0.9064
AT2G01140 PDE345 PIGMENT DEFECTIVE 345, Aldolas... Lus10034619 20.0 0.9277
AT4G35630 PSAT phosphoserine aminotransferase... Lus10039587 21.6 0.9011
AT1G67325 Ran BP2/NZF zinc finger-like s... Lus10006412 23.5 0.9137

Lus10012679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.