Lus10012683 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10500 203 / 3e-67 ATCPISCA chloroplast-localized ISCA-like protein (.1)
AT2G16710 75 / 1e-17 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
AT2G36260 70 / 6e-16 Iron-sulphur cluster biosynthesis family protein (.1)
AT5G03905 67 / 3e-14 Iron-sulphur cluster biosynthesis family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020827 284 / 3e-99 AT1G10500 216 / 1e-72 chloroplast-localized ISCA-like protein (.1)
Lus10014201 65 / 2e-13 AT5G03905 204 / 2e-68 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10017048 65 / 3e-13 AT2G16710 220 / 5e-75 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Lus10022714 64 / 6e-13 AT5G03905 201 / 3e-67 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10021368 56 / 2e-09 AT2G16710 211 / 3e-69 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G079600 209 / 1e-69 AT1G10500 210 / 5e-70 chloroplast-localized ISCA-like protein (.1)
Potri.005G085400 206 / 1e-68 AT1G10500 227 / 9e-77 chloroplast-localized ISCA-like protein (.1)
Potri.010G238800 74 / 3e-17 AT2G16710 211 / 2e-71 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Potri.008G020400 74 / 3e-17 AT2G16710 197 / 5e-66 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Potri.006G084300 69 / 7e-15 AT5G03905 199 / 2e-66 Iron-sulphur cluster biosynthesis family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis
Representative CDS sequence
>Lus10012683 pacid=23148173 polypeptide=Lus10012683 locus=Lus10012683.g ID=Lus10012683.BGIv1.0 annot-version=v1.0
ATGGCGATGGCGTTCTCTCCGTCGACAACCACTGCCCACAAGTCCTCTTCATCTCCCTGTCTTCTCCGCCTTCCCAATCGCTCTTCACCTCCGAATTCAG
TCTCCTTCAGATTCTTCTCCACGACCAACATATGCCGCAGATCGTCTCTGTCCGTTAGGTCGTCGGCTTCAGCCTCAGTTGCTCCGCCGTCTGCCGGGGG
AGTGGCGCCGGCGGTATCGTTGACTGAGACTGCGTTGAAGCACTTGAATCGGATGAGGAGTGACCGTGGTGAGGATTTGTGCTTGAGAATTGGGGTGAAG
CAAGGTGGGTGCTCCGGTATGTCTTACACCATGGACTTCGAGAGTAGGGATAACGCTAGAGCTGACGATTCTATTATTGAATATGACGGCTTTGTCATCG
TTTGTGATCCAAAGAGCCTCCTTTTCATGTTCGGGATGCAACTGGATTACAGCGATGCGCTCATCGGAGGTGGCTTCTCTTTCAAGAACCCGAACGCTAC
ACAGACGTGTGGTTGTGGTAAATCTTTTGCAGCAGACATGTGA
AA sequence
>Lus10012683 pacid=23148173 polypeptide=Lus10012683 locus=Lus10012683.g ID=Lus10012683.BGIv1.0 annot-version=v1.0
MAMAFSPSTTTAHKSSSSPCLLRLPNRSSPPNSVSFRFFSTTNICRRSSLSVRSSASASVAPPSAGGVAPAVSLTETALKHLNRMRSDRGEDLCLRIGVK
QGGCSGMSYTMDFESRDNARADDSIIEYDGFVIVCDPKSLLFMFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAADM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10500 ATCPISCA chloroplast-localized ISCA-lik... Lus10012683 0 1
AT1G76570 Chlorophyll A-B binding family... Lus10005421 1.0 0.8466
AT4G22260 IM1, IM IMMUTANS, Alternative oxidase ... Lus10037518 6.6 0.8336
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10040982 6.9 0.8214
AT2G01110 TATC, PGA2, APG... unfertilized embryo sac 3, TWI... Lus10007945 7.6 0.7903
AT2G21970 SEP2 stress enhanced protein 2 (.1) Lus10036629 9.2 0.8347
AT5G61820 unknown protein Lus10042158 9.9 0.8123
AT4G09620 Mitochondrial transcription te... Lus10009420 11.0 0.8122
AT4G17440 Protein of unknown function (D... Lus10004378 11.2 0.8235
AT5G57040 Lactoylglutathione lyase / gly... Lus10021574 12.4 0.8352
AT5G40650 SDH2-2 succinate dehydrogenase 2-2 (.... Lus10014879 16.1 0.8130

Lus10012683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.