Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11040 109 / 3e-29 HSP40/DnaJ peptide-binding protein (.1) AT1G44160 99 / 1e-25 HSP40/DnaJ peptide-binding protein (.1) AT1G59725 90 / 2e-22 DNAJ heat shock family protein (.1) AT3G08910 88 / 1e-21 DNAJ heat shock family protein (.1) AT1G10350 88 / 2e-21 DNAJ heat shock family protein (.1) AT5G01390 84 / 5e-20 DNAJ heat shock family protein (.1.2.3.4) AT5G25530 83 / 1e-19 DNAJ heat shock family protein (.1) AT4G28480 81 / 5e-19 DNAJ heat shock family protein (.1.2) AT2G20560 80 / 1e-18 DNAJ heat shock family protein (.1) AT2G20550 77 / 1e-17 HSP40/DnaJ peptide-binding protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020822 [exp] 229 / 1e-76 AT1G11040 182 / 7e-54 HSP40/DnaJ peptide-binding protein (.1) Lus10029685 [exp] 104 / 4e-27 AT1G11040 257 / 1e-80 HSP40/DnaJ peptide-binding protein (.1) Lus10042725 [exp] 102 / 3e-26 AT1G11040 256 / 2e-80 HSP40/DnaJ peptide-binding protein (.1) Lus10025682 [exp] 100 / 1e-25 AT1G11040 241 / 4e-75 HSP40/DnaJ peptide-binding protein (.1) Lus10018152 [exp] 99 / 3e-25 AT1G11040 246 / 5e-77 HSP40/DnaJ peptide-binding protein (.1) Lus10015402 [exp] 93 / 2e-23 AT2G20560 483 / 7e-173 DNAJ heat shock family protein (.1) Lus10013981 [exp] 88 / 2e-21 AT2G20560 488 / 8e-175 DNAJ heat shock family protein (.1) Lus10005033 [exp] 85 / 3e-20 AT3G08910 503 / 0.0 DNAJ heat shock family protein (.1) Lus10027803 [exp] 84 / 3e-20 AT3G08910 504 / 0.0 DNAJ heat shock family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G211800 [exp] 114 / 9e-32 AT1G11040 197 / 2e-59 HSP40/DnaJ peptide-binding protein (.1) Potri.002G081700 [exp] 103 / 3e-27 AT1G11040 253 / 1e-80 HSP40/DnaJ peptide-binding protein (.1) Potri.005G179400 [exp] 100 / 7e-26 AT1G11040 250 / 2e-79 HSP40/DnaJ peptide-binding protein (.1) Potri.011G057601 [exp] 93 / 2e-23 AT2G20560 444 / 2e-157 DNAJ heat shock family protein (.1) Potri.007G135700 [exp] 91 / 1e-22 AT2G20560 416 / 3e-146 DNAJ heat shock family protein (.1) Potri.018G034600 [exp] 90 / 2e-22 AT5G25530 410 / 8e-144 DNAJ heat shock family protein (.1) Potri.017G016100 [exp] 88 / 1e-21 AT2G20560 420 / 7e-148 DNAJ heat shock family protein (.1) Potri.007G136700 [exp] 87 / 3e-21 AT2G20560 416 / 5e-146 DNAJ heat shock family protein (.1) Potri.017G016000 [exp] 87 / 5e-21 AT2G20560 419 / 4e-147 DNAJ heat shock family protein (.1) Potri.010G035000 [exp] 83 / 9e-20 AT1G10350 429 / 1e-151 DNAJ heat shock family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01556 [flax] [poplar] DnaJ_C DnaJ C terminal domain
Representative CDS sequence Show only first row Show all	>Lus10012688 pacid=23148208 polypeptide=Lus10012688 locus=Lus10012688.g ID=Lus10012688.BGIv1.0 annot-version=v1.0 ATGCCTGCCCCGTTGGTGTTTACAGCGTCGACGACAATAAGAAAGCCTCCTCCTGTTGAAATGATAGTAGACTGCACTCTCGAAGAGGTGTTTCGGGGCC GTGTCAAGCGTATCAAAATCGAAGAAGAAACTGTAAAGATCAAATTTACCCCGGGATTGAAGTCCGGCACGAAGATCACCTTCGAAGGCAAACCGCCCAA TGACGACGATAAATCAGGCGGTAGCAGCCGCCTAATCCCAAGCGACGTGGTACTAGTAATCCAAGAAAAGCCACACCATTTATTCAGCAGAGACGGCGAC AACTTGGTCTACGATGTTGACATCCCGTTGACCGACGCCCTCACCGGTTGTACCTTATCGGTACCAATGCTCGGCAGGGACCACATGTAG
AA sequence Show only first row Show all	>Lus10012688 pacid=23148208 polypeptide=Lus10012688 locus=Lus10012688.g ID=Lus10012688.BGIv1.0 annot-version=v1.0 MPAPLVFTASTTIRKPPPVEMIVDCTLEEVFRGRVKRIKIEEETVKIKFTPGLKSGTKITFEGKPPNDDDKSGGSSRLIPSDVVLVIQEKPHHLFSRDGD NLVYDVDIPLTDALTGCTLSVPMLGRDHM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10012688 [exp]	0	1

Compare expression of checked genes

Lus10012688 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.