Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58060 71 / 2e-15 RNA helicase family protein (.1) AT1G58050 46 / 1e-06 RNA helicase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020816 [exp] 104 / 6e-27 AT1G58060 480 / 3e-154 RNA helicase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G222900 [exp] 61 / 9e-12 AT1G58060 1757 / 0.0 RNA helicase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012694 pacid=23148157 polypeptide=Lus10012694 locus=Lus10012694.g ID=Lus10012694.BGIv1.0 annot-version=v1.0 ATGATATCCATCACAGCACCGTCACTGTTCTCACGTAACTGCATCGACCATCATAGTCTTTCTGCTACTGACTCTCTCTTCGCCGTCGCCGAGAAAACCG ATGCCTCCGAAGAAGAAGCCACCGCCGCAGAGGTGGGGCACGAAATCGAAATCCCAGTCCCAATCATCGAGTTCGTCGGGTCCGAAGCTGCAAATATCAT CGAGAACCGTCTTCGTCCTCTATTGCTCAACTCTGGCCAGTCTGCCCAGTCTTTTCCGGTGGCAGCACCGGTTGAAGACAATCTCTCCAAAGCTCAAAAG GCGAAGAAATTGACGGCCATTTACGAGAACCTCTCTTGCGAAGGGTTCTCAGACAATCAAATTGTATGA
AA sequence Show only first row Show all	>Lus10012694 pacid=23148157 polypeptide=Lus10012694 locus=Lus10012694.g ID=Lus10012694.BGIv1.0 annot-version=v1.0 MISITAPSLFSRNCIDHHSLSATDSLFAVAEKTDASEEEATAAEVGHEIEIPVPIIEFVGSEAANIIENRLRPLLLNSGQSAQSFPVAAPVEDNLSKAQK AKKLTAIYENLSCEGFSDNQIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58060			RNA helicase family protein (....		Lus10012694 [exp]	0	1
AT1G26930			Galactose oxidase/kelch repeat...		Lus10023608 [exp]	5.1	0.6934
AT2G34930			disease resistance family prot...		Lus10001034 [exp]	7.3	0.6233
					Lus10040421 [exp]	8.9	0.7300
AT1G78610		MSL6	mechanosensitive channel of sm...		Lus10023990 [exp]	10.0	0.5884
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10000678 [exp]	13.5	0.6509
AT5G14380		AGP6	arabinogalactan protein 6 (.1)		Lus10022309 [exp]	22.5	0.5746
AT2G36540			Haloacid dehalogenase-like hyd...		Lus10019760 [exp]	29.1	0.6309
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10006924 [exp]	32.9	0.5677
AT1G35467		RALFL5	RALF-like 5 (.1)		Lus10006213 [exp]	35.7	0.5419
AT2G30340	AS2	LBD13	LOB domain-containing protein ...		Lus10029061 [exp]	36.9	0.6039

Compare expression of checked genes

Lus10012694 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.