Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001300 [exp] 129 / 8e-39 AT2G14095 52 / 7e-08 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012705 pacid=23148176 polypeptide=Lus10012705 locus=Lus10012705.g ID=Lus10012705.BGIv1.0 annot-version=v1.0 ATGGCCTCCTCCTCCTTCACTGCTGCTGCACCACTCCATGGCTTACCAATCATTCGACGTCGTTTGATGAAGATGACTATCAATGCTTCTCTGTTTCCTC CTCGTCATGTTAGCTGCCTAAGAAGCAATGTTCTGTTCACTACAAGCTGCATGGAGCGGAAGAAAAAGATGTGTCGCGGGAATACGAGTGCTCGTTGCAT TAGTGGCCTTCCGGTCTCCAATTTCCCGTCTCTTCCTCCAACCCCTTTTCCTGGTTCGTGGTGA
AA sequence Show only first row Show all	>Lus10012705 pacid=23148176 polypeptide=Lus10012705 locus=Lus10012705.g ID=Lus10012705.BGIv1.0 annot-version=v1.0 MASSSFTAAAPLHGLPIIRRRLMKMTINASLFPPRHVSCLRSNVLFTTSCMERKKKMCRGNTSARCISGLPVSNFPSLPPTPFPGSW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012705 [exp]	0	1
AT1G23820		SPDS1	spermidine synthase 1 (.1.2)		Lus10039416 [exp]	3.9	0.9452
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10041644 [exp]	9.0	0.9483
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10005399 [exp]	11.5	0.9500
AT4G02280		ATSUS3, SUS3	sucrose synthase 3 (.1)		Lus10013417 [exp]	11.8	0.9430
AT4G23690			Disease resistance-responsive ...		Lus10032331 [exp]	11.9	0.9523
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10021318 [exp]	12.8	0.9467
AT3G52710			unknown protein		Lus10021354 [exp]	13.8	0.9272
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10036194 [exp]	16.5	0.9436
AT1G13550			Protein of unknown function (D...		Lus10031914 [exp]	17.0	0.9225
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10023271 [exp]	23.2	0.9390

Compare expression of checked genes

Lus10012705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.