Lus10012711 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44360 145 / 6e-46 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G230100 152 / 1e-48 AT2G44360 158 / 4e-51 unknown protein
PFAM info
Representative CDS sequence
>Lus10012711 pacid=23148185 polypeptide=Lus10012711 locus=Lus10012711.g ID=Lus10012711.BGIv1.0 annot-version=v1.0
ATGGCGGAAGGAGGTAATAAAGCAGATGATCAGCTCTTCCAGCTCCTCTCCGGTCTTCTTCAGCAAGTTGAAGCACTGACTAATGAGGAAGAAGTGGAAT
TGAGGTCCAAGATTGAAGCTTTAGGATTAGAGGTTACGAAAGTCCCATCGAAGTCGACCAAATCCCTCGATGAGTTGGAGATAGCAGGGGAATTGGATAA
GCTATCGGAGAAGTTGGCCAATGTGGATGAGATGATATCGTCAGCCATGGTTGACGATCCACAAGTGCAGTCGCTCTTGAGCGACACTGCTGATGTATGG
ATGCCGGTGATCACAGCTGGCGCCGACGAGAGGAAGAACTTCACAGGAGGATCATCATCAGCATCAACTGGCAGCACTCCCAGTTCCCATCCCAATTGA
AA sequence
>Lus10012711 pacid=23148185 polypeptide=Lus10012711 locus=Lus10012711.g ID=Lus10012711.BGIv1.0 annot-version=v1.0
MAEGGNKADDQLFQLLSGLLQQVEALTNEEEVELRSKIEALGLEVTKVPSKSTKSLDELEIAGELDKLSEKLANVDEMISSAMVDDPQVQSLLSDTADVW
MPVITAGADERKNFTGGSSSASTGSTPSSHPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44360 unknown protein Lus10012711 0 1
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147 1.0 0.8907
AT5G10780 unknown protein Lus10040473 5.5 0.8434
AT4G35980 unknown protein Lus10041889 6.0 0.8461
AT1G69980 unknown protein Lus10010734 8.7 0.8345
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Lus10016977 10.5 0.8049
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10019084 11.0 0.8358
AT4G21105 cytochrome-c oxidases;electron... Lus10020569 11.5 0.7385
AT3G03100 NADH:ubiquinone oxidoreductase... Lus10007886 12.5 0.7611
AT1G55340 Protein of unknown function (D... Lus10010650 15.7 0.8305
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Lus10036125 15.7 0.8092

Lus10012711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.