Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57290 83 / 1e-21 60S acidic ribosomal protein family (.1.2.3) AT4G25890 79 / 4e-20 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010890 [exp] 114 / 1e-33 AT5G57290 102 / 4e-29 60S acidic ribosomal protein family (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G032600 [exp] 96 / 2e-26 AT5G57290 106 / 8e-31 60S acidic ribosomal protein family (.1.2.3) Potri.003G010200 [exp] 91 / 1e-24 AT5G57290 102 / 4e-29 60S acidic ribosomal protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10012714 pacid=23148232 polypeptide=Lus10012714 locus=Lus10012714.g ID=Lus10012714.BGIv1.0 annot-version=v1.0 ATGGGAGTTTTCACCTTCGTTTGCAAGAGCTCCGGCGACGAGTGGAGCGGAAAGCAGATCGCCGGCGGTGACCTCGAGGCATCAGCCCCATCCACCTTCG ATCTGCAGAGGAAGCTCGTCCAGACTGTCCTCGCAACCGATTCCTCCGGAGGAGTTCGTTCTTCTTTCTCCCTCGTCTCTCCCAGCTCTGCCGTCTTCCA GGTGATCGTCGGCGGTTCAGTCGGAGGCGGAGGGCTCGTGAGCAGCGGGGGAGGCGGTGGTTCTGCACCGGCCGCAGCAGCAGCTGATGCACCCGCAGTT GAGGAGAAGAAGGAAGAGGAGAAAGATGAGAGTGACGATGACTTGGGATTCTCGCTCTTTGATTAG
AA sequence Show only first row Show all	>Lus10012714 pacid=23148232 polypeptide=Lus10012714 locus=Lus10012714.g ID=Lus10012714.BGIv1.0 annot-version=v1.0 MGVFTFVCKSSGDEWSGKQIAGGDLEASAPSTFDLQRKLVQTVLATDSSGGVRSSFSLVSPSSAVFQVIVGGSVGGGGLVSSGGGGGSAPAAAAADAPAV EEKKEEEKDESDDDLGFSLFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Lus10037177 [exp]	2.4	0.9549
AT3G16780			Ribosomal protein L19e family ...		Lus10037707 [exp]	2.8	0.9421
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	4.9	0.9540
AT1G07770		RPS15A	ribosomal protein S15A (.1.2)		Lus10043001 [exp]	5.3	0.9387
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	8.5	0.9474
AT5G12110			Glutathione S-transferase, C-t...		Lus10036101 [exp]	9.4	0.9372
AT5G20920		EIF2 BETA, EMB1...	embryo defective 1401, eukaryo...		Lus10007559 [exp]	9.8	0.9186
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	10.5	0.9398
AT1G13690		ATE1	ATPase E1 (.1)		Lus10004641 [exp]	12.4	0.9328
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	13.0	0.9338

Compare expression of checked genes

Lus10012714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.