Lus10012740 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025731 42 / 3e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012740 pacid=23148233 polypeptide=Lus10012740 locus=Lus10012740.g ID=Lus10012740.BGIv1.0 annot-version=v1.0
ATGAATTCATCAATGGTGAAGCTATTCCTAATCCTCGGCCTACTGGCCACTTCCTGTGTCGCTCAGGCTCCAACCGCCACCCCAACTCCATCTCCCACCG
CTGTCCCCACTCCTCCATCTCCATCTCCGTCTCCGGCCGCCACTCCGACTCCGACTCCTACTCCAGCACCTGCTCCGGCTCCACTCACCCCTGCTCCGAC
CCCAGCTCCTACCACATCGCCGACTCCTTCGCCTTCCCCTGTCGCCTCCGCCCCCAGTCCCGACGCCGCTTCTCCTCCGGCTCCTCCTACTTCTCCAGCT
GGCTCCCCCGCCGGCGGTCCGTCTTCCGACGATGTCCCTCCAAACTTCGCCGCCGGATTTGACAGAGTGATCGTTGCCGGTACTGCCGTTTCGGCTGCTT
TGTTGGCCTTCGTCGTCTTGGCTTAG
AA sequence
>Lus10012740 pacid=23148233 polypeptide=Lus10012740 locus=Lus10012740.g ID=Lus10012740.BGIv1.0 annot-version=v1.0
MNSSMVKLFLILGLLATSCVAQAPTATPTPSPTAVPTPPSPSPSPAATPTPTPTPAPAPAPLTPAPTPAPTTSPTPSPSPVASAPSPDAASPPAPPTSPA
GSPAGGPSSDDVPPNFAAGFDRVIVAGTAVSAALLAFVVLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012740 0 1
AT1G24530 Transducin/WD40 repeat-like su... Lus10006233 1.0 0.8850
AT5G56040 Leucine-rich receptor-like pro... Lus10042090 1.4 0.8752
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10007525 2.2 0.8549
AT1G05070 Protein of unknown function (D... Lus10035288 2.4 0.8408
AT1G73880 UGT89B1 UDP-glucosyl transferase 89B1 ... Lus10021718 2.8 0.8560
AT3G02645 Plant protein of unknown funct... Lus10009504 3.0 0.8565
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10011476 6.0 0.8187
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Lus10027573 6.6 0.8189
AT4G36750 Quinone reductase family prote... Lus10011292 8.4 0.7642
AT3G06890 unknown protein Lus10006514 10.8 0.7775

Lus10012740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.