Lus10012744 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
AT5G10400 271 / 2e-95 Histone superfamily protein (.1)
AT5G10390 271 / 2e-95 Histone superfamily protein (.1)
AT3G27360 271 / 2e-95 Histone superfamily protein (.1)
AT1G09200 271 / 2e-95 Histone superfamily protein (.1)
AT4G40040 265 / 5e-93 Histone superfamily protein (.1.2)
AT4G40030 265 / 5e-93 Histone superfamily protein (.1.2.3)
AT5G10980 265 / 5e-93 Histone superfamily protein (.1)
AT5G65350 259 / 6e-91 HTR11 histone 3 11 (.1)
AT1G75600 256 / 2e-89 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 272 / 6e-96 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 272 / 6e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 272 / 6e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 272 / 6e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 272 / 6e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10031821 274 / 1e-95 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 273 / 3e-95 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10031252 269 / 1e-94 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10012757 220 / 1e-75 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 272 / 5e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016900 271 / 2e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 265 / 5e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 265 / 5e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10012744 pacid=23148200 polypeptide=Lus10012744 locus=Lus10012744.g ID=Lus10012744.BGIv1.0 annot-version=v1.0
ATGGCACGTACAAAACAAACAGCTAGGAAATCCACCGGGGGAAAGGCCCCCAGGAAGCAACTAGCAACAAAGGCGGCGAGGAAGTCAGCTCCGGCAACCG
GCGGAGTGAAGAAGCCACACAGGTTCAGGCCAGGCACGGTGGCGTTGAGGGAGATAAGGAAGTATCAGAAGAGCACTGAGCTTTTAATCAGGAAGCTTCC
GTTTCAGAGGCTGGTTAGGGAGATTGCACAGGATTTCAAGACGGATCTGAGGTTCCAGAGCAGCGCCGTCTCCGCTCTGCAGGAAGCGGCGGAGGCTTAT
CTGGTTGGAATGTTTGAGGACACAAATCTCTGTGCTATTCATGCTAAGAGGGTCACCATTATGCCCAAGGATATCCAGCTCGCTAGGAGGATTCGAGGGG
AACGAGCTTAG
AA sequence
>Lus10012744 pacid=23148200 polypeptide=Lus10012744 locus=Lus10012744.g ID=Lus10012744.BGIv1.0 annot-version=v1.0
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAY
LVGMFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65360 Histone superfamily protein (.... Lus10012744 0 1
AT3G27360 Histone superfamily protein (.... Lus10031821 1.0 0.9705
AT1G09200 Histone superfamily protein (.... Lus10031250 1.4 0.9576
AT5G23420 HMGB6 high-mobility group box 6 (.1.... Lus10013453 2.4 0.9549
AT2G29570 ATPCNA2, PCNA2 A. THALIANA PROLIFERATING CELL... Lus10005874 3.5 0.9506
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10016156 4.5 0.9329
AT3G27640 Transducin/WD40 repeat-like su... Lus10014560 4.6 0.9360
AT5G43250 CCAAT NF-YC13 "nuclear factor Y, subunit C13... Lus10030832 4.7 0.9269
AT3G54560 HTA11 histone H2A 11 (.1) Lus10024838 5.7 0.9354
AT4G01270 RING/U-box superfamily protein... Lus10018817 6.5 0.9362
AT4G13690 unknown protein Lus10000756 6.7 0.9415

Lus10012744 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.