Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023159 [exp] 64 / 1e-13 AT4G40060 220 / 1e-70 homeobox protein 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G071900 [exp] 41 / 3e-05 AT2G22430 248 / 6e-81 homeobox protein 6 (.1) Potri.007G097100 [exp] 38 / 0.0003 AT2G22430 250 / 9e-82 homeobox protein 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012752 pacid=23148228 polypeptide=Lus10012752 locus=Lus10012752.g ID=Lus10012752.BGIv1.0 annot-version=v1.0 ATGAAGAGATCACTTGGGAGCACCGACTCTTTCGGAGCTCTCGTCTCCACCATCGCAACCTCTGAAGAGAAGCACGGCAGCCCGAGGAACAGTAGCGGCG GAGGACACTTGTACGGCATGTTGGAGGAGGAGGAAGGCGGAGTAGGAGGAGGAGGAGGGGAAGAGTACTCTGCCGGCGGATGCGGCGGTAGCGGGGGGGT GGGGGGGACGAAGGAGGCGGCTGAGCGTAGTACAAGTGAAAGCGCTGGAGAAGAATTTCGAGGTGGAGAATAA
AA sequence Show only first row Show all	>Lus10012752 pacid=23148228 polypeptide=Lus10012752 locus=Lus10012752.g ID=Lus10012752.BGIv1.0 annot-version=v1.0 MKRSLGSTDSFGALVSTIATSEEKHGSPRNSSGGGHLYGMLEEEEGGVGGGGGEEYSAGGCGGSGGVGGTKEAAERSTSESAGEEFRGGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012752 [exp]	0	1
AT4G40060	HD	ATHB16 ,ATHB-16	homeobox protein 16 (.1)		Lus10023159 [exp]	1.4	0.8536
AT4G40060	HD	ATHB16 ,ATHB-16	homeobox protein 16 (.1)		Lus10012753 [exp]	1.4	0.8488
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10011335 [exp]	4.6	0.8151
AT5G41020	MYB		myb family transcription facto...		Lus10022926 [exp]	6.3	0.8012
AT1G06920	OFP	ATOFP4, OFP4	ARABIDOPSIS THALIANA OVATE FAM...		Lus10014164 [exp]	6.5	0.7538
AT1G74250			DNAJ heat shock N-terminal dom...		Lus10017846 [exp]	6.9	0.7885
AT2G03550			alpha/beta-Hydrolases superfam...		Lus10019882 [exp]	8.1	0.7634
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10001594 [exp]	8.4	0.8003
AT3G27250			unknown protein		Lus10014610 [exp]	11.5	0.7631
AT3G57540			Remorin family protein (.1)		Lus10042367 [exp]	17.2	0.7731

Compare expression of checked genes

Lus10012752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.