Lus10012760 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52800 45 / 5e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 43 / 2e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 40 / 0.0003 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021025 117 / 2e-32 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005776 85 / 3e-20 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005774 81 / 7e-19 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773 81 / 8e-19 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027419 49 / 4e-08 AT1G52800 89 / 4e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176500 42 / 7e-05 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000 42 / 8e-05 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10012760 pacid=23142336 polypeptide=Lus10012760 locus=Lus10012760.g ID=Lus10012760.BGIv1.0 annot-version=v1.0
ATGGGCTACACTAGTATTCCCATGATCGATCTGTCTAAAGTGAGGCCTGAAAGCGAGTCCTGGAATTCAACTGGAGCAGCCGTGAAATTGGCAATGGAGC
AGTTTGGGTGTTTCCAGGCAATATACCAAGCCCCCGGAGAAAAATATTCCTATTTACGAGGCAGTACAAGAGCTGTTCAATTTTCCGGAAGAGATGAAGA
GCCGGAACACAAGCACCAAGCCCTTGTTCGGGGCTCGACTCCAAAACCTCACCACCCACTCGACGAAACACTAGTAATTGATGGCCTCGATAAGACGAGT
CTCGAGATGTCGAAACGACTAGTGGAAGTGCACGACACAGTGTTGAAGATGGTGAACGAGAGCTACAAGCAGGAGGCTGAATTTGTGGGGTTCGCAAACG
AGTCCTTAAACTACAAAATCCGGTATTTGAAGTACCACATACCACCCCCGAACTAA
AA sequence
>Lus10012760 pacid=23142336 polypeptide=Lus10012760 locus=Lus10012760.g ID=Lus10012760.BGIv1.0 annot-version=v1.0
MGYTSIPMIDLSKVRPESESWNSTGAAVKLAMEQFGCFQAIYQAPGEKYSYLRGSTRAVQFSGRDEEPEHKHQALVRGSTPKPHHPLDETLVIDGLDKTS
LEMSKRLVEVHDTVLKMVNESYKQEAEFVGFANESLNYKIRYLKYHIPPPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10012760 0 1
Lus10025095 4.0 0.9773
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 4.1 0.9815
AT4G16195 Plant self-incompatibility pro... Lus10011069 5.3 0.9417
Lus10021782 5.8 0.9815
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 7.1 0.9815
AT2G34320 Polynucleotidyl transferase, r... Lus10039942 8.2 0.9815
Lus10040759 9.2 0.7974
AT1G17930 Aminotransferase-like, plant m... Lus10016922 9.2 0.9815
AT1G48120 hydrolases;protein serine/thre... Lus10015869 10.1 0.9815
Lus10007927 10.9 0.9815

Lus10012760 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.