Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12490 82 / 6e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12100 80 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 81 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 80 / 2e-19 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 75 / 1e-17 AZI1 azelaic acid induced 1 (.1) AT4G12520 71 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 71 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 71 / 4e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 71 / 5e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 69 / 1e-15 ELP extensin-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036494 [exp] 94 / 2e-25 AT4G12480 75 / 5e-18 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 81 / 6e-20 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024616 [exp] 79 / 1e-19 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 80 / 2e-19 ND 139 / 6e-43 Lus10032254 [exp] 79 / 2e-19 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 79 / 2e-19 ND 139 / 2e-43 Lus10004346 [exp] 77 / 8e-19 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 77 / 1e-18 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 77 / 2e-18 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G121800 [exp] 79 / 1e-19 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 78 / 6e-19 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 77 / 1e-18 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 74 / 2e-17 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 69 / 8e-16 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 68 / 3e-15 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 61 / 6e-12 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.016G015500 [exp] 61 / 1e-11 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 58 / 2e-11 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008300 [exp] 59 / 3e-11 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10012763 pacid=23142339 polypeptide=Lus10012763 locus=Lus10012763.g ID=Lus10012763.BGIv1.0 annot-version=v1.0 ATGAGCTCTAACCAGTACAATCCCAATTATTCCACCTTTAGACTCATCTCTCTACCATTTCTTCTTCTGTTGATCATCATTATAAGTTGCAATCTGACCA CGACCACACTAGCCCAGGAAGATGGAGGAGGAGATGCCGGAGATGGAGGAGGAGGAGGAGATTCCGGATCAGGCGGCAACAACACATTCCCAGTGGTTGG GAGATGCTCCATAGACCTGTTCCGGCTGGCAGTGTGCACGCCATTGGTAACAGTGGACGTGGGGAGCCTAGCGAGCAGGCCTTGTTGTGCAGCTCTGCTG GGCCTAGTGGACATGGAGGCCACAGTTTGTCTTTGCCTTGCTCTCAGGGCTAACGTCCTTGGCATCCACATTGATGTTCCCTTGGCTCTCAGTTTGATTA TTTCCACTTGTTACTCCACCCTTCCTCCTTATTACTTCGAATGTCATTCACCACCTTAA
AA sequence Show only first row Show all	>Lus10012763 pacid=23142339 polypeptide=Lus10012763 locus=Lus10012763.g ID=Lus10012763.BGIv1.0 annot-version=v1.0 MSSNQYNPNYSTFRLISLPFLLLLIIIISCNLTTTTLAQEDGGGDAGDGGGGGDSGSGGNNTFPVVGRCSIDLFRLAVCTPLVTVDVGSLASRPCCAALL GLVDMEATVCLCLALRANVLGIHIDVPLALSLIISTCYSTLPPYYFECHSPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10012763 [exp]	0	1
AT3G46140			Protein kinase superfamily pro...		Lus10031910 [exp]	1.0	0.7165
AT5G38940			RmlC-like cupins superfamily p...		Lus10038441 [exp]	6.3	0.6309
					Lus10008418 [exp]	7.1	0.7124
					Lus10034849 [exp]	11.7	0.6836
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10000168 [exp]	13.6	0.6433
					Lus10021760 [exp]	14.4	0.6246
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10002395 [exp]	14.9	0.6433
AT5G44390			FAD-binding Berberine family p...		Lus10026290 [exp]	27.4	0.6912
					Lus10003753 [exp]	33.7	0.6106
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000682 [exp]	34.9	0.6106

Compare expression of checked genes

Lus10012763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.