Lus10012766 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21480 50 / 1e-07 STP12 sugar transporter protein 12 (.1)
AT1G07340 47 / 2e-06 ATSTP2 sugar transporter 2 (.1)
AT4G02050 47 / 2e-06 STP7 sugar transporter protein 7 (.1)
AT1G11260 44 / 2e-05 ATSTP1, STP1 sugar transporter 1 (.1)
AT5G23270 42 / 7e-05 ATSTP11, STP11 sugar transporter 11 (.1)
AT5G26340 41 / 0.0002 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
AT1G77210 41 / 0.0002 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2)
AT3G19940 41 / 0.0002 Major facilitator superfamily protein (.1)
AT5G61520 40 / 0.0005 Major facilitator superfamily protein (.1.2)
AT3G05960 39 / 0.0008 ATSTP6 sugar transporter 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028729 132 / 3e-39 AT3G19940 62 / 1e-11 Major facilitator superfamily protein (.1)
Lus10012596 74 / 7e-17 AT1G11260 65 / 2e-12 sugar transporter 1 (.1)
Lus10002597 49 / 7e-07 AT1G11260 798 / 0.0 sugar transporter 1 (.1)
Lus10018422 49 / 7e-07 AT1G11260 835 / 0.0 sugar transporter 1 (.1)
Lus10040991 48 / 1e-06 AT3G19940 666 / 0.0 Major facilitator superfamily protein (.1)
Lus10022421 44 / 2e-05 AT1G77210 790 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2)
Lus10020934 42 / 9e-05 AT1G34580 664 / 0.0 Major facilitator superfamily protein (.1)
Lus10019070 41 / 0.0002 AT4G02050 538 / 0.0 sugar transporter protein 7 (.1)
Lus10013441 41 / 0.0002 AT1G50310 731 / 0.0 sugar transporter 9 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G033600 49 / 3e-07 AT1G11260 822 / 0.0 sugar transporter 1 (.1)
Potri.016G120700 49 / 5e-07 AT5G61520 570 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.001G110400 48 / 7e-07 AT1G11260 658 / 0.0 sugar transporter 1 (.1)
Potri.004G101950 48 / 9e-07 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
Potri.004G101900 48 / 9e-07 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
Potri.011G042100 47 / 2e-06 AT1G11260 808 / 0.0 sugar transporter 1 (.1)
Potri.004G109765 47 / 3e-06 AT1G11260 630 / 0.0 sugar transporter 1 (.1)
Potri.004G110630 47 / 3e-06 AT1G11260 629 / 0.0 sugar transporter 1 (.1)
Potri.007G073850 46 / 5e-06 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G073800 46 / 5e-06 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10012766 pacid=23142333 polypeptide=Lus10012766 locus=Lus10012766.g ID=Lus10012766.BGIv1.0 annot-version=v1.0
ATGCTCATAGCAGAACATGTCGTCTTTGCTTGCATCGGAGTAGGCTTCTCCGTCCAATCCACGCAAGCCTACGCAGCTCGGAACCCATCCATTTGTTATC
CCATAATCAAACGAGTTTTATCAGTCTGCGGTATTCGTCAGGCAGGGGCCGTGGCGCATGAGTCTAGGAGTAGCGTGCCTCTTGTGCACCTTCTCTTCAT
CATCGGCCTTCCCAACGCACCAGAAGATGTACACGCAGAAGATGAGTCTCCAGATATTAAAGTCGCTGCCAACGTGGCAACCGGGTTAGCAACAACATGC
CCCAACATCAAGCCACGTCATCCTAGTCACTACCTAGTGGCGGCGCTGGCAGTCCCGTTGTTAATGCAGAAGTTGACCGGAGTCAACCTTGTGTTGATGT
TTTATGCTCCGGTACTTTTCCAAACCATCGTCCCGGGCTGCAACTCCTCCTTGGTTTTCTCTGTCAATTTCCGTTATGCCTTGTGTTTTTGTTTAGGGAC
TCTCGCTTCTTAG
AA sequence
>Lus10012766 pacid=23142333 polypeptide=Lus10012766 locus=Lus10012766.g ID=Lus10012766.BGIv1.0 annot-version=v1.0
MLIAEHVVFACIGVGFSVQSTQAYAARNPSICYPIIKRVLSVCGIRQAGAVAHESRSSVPLVHLLFIIGLPNAPEDVHAEDESPDIKVAANVATGLATTC
PNIKPRHPSHYLVAALAVPLLMQKLTGVNLVLMFYAPVLFQTIVPGCNSSLVFSVNFRYALCFCLGTLAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21480 STP12 sugar transporter protein 12 (... Lus10012766 0 1
AT2G21100 Disease resistance-responsive ... Lus10034473 5.7 0.8762
AT4G33985 Protein of unknown function (D... Lus10027898 7.3 0.8757
Lus10017290 10.8 0.8266
AT2G15220 Plant basic secretory protein ... Lus10001358 13.2 0.8146
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10030271 13.8 0.6272
AT3G50845 Protein of unknown function (D... Lus10014311 17.9 0.8176
Lus10013963 20.5 0.8137
AT2G23660 AS2 LBD10 LOB domain-containing protein ... Lus10009337 21.1 0.5523
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Lus10009400 23.8 0.8108
AT1G76520 Auxin efflux carrier family pr... Lus10013200 26.4 0.8085

Lus10012766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.