Lus10012783 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033992 44 / 2e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012783 pacid=23142366 polypeptide=Lus10012783 locus=Lus10012783.g ID=Lus10012783.BGIv1.0 annot-version=v1.0
ATGCCAAGGTACCGGAGTCGTAGCAGGAGCTACAGCCCTCGTCGCCGCAGCAGAAGCCCGCCTCGTCTCCGCAAGCGGTACGACGATGATGTCGATGAAC
CTCGTGATCGATTCCGTGAGAGTCGCTCCCACAGAGACCGTCGCTCTCCTGCTCCTTCTGGTTTGCTCGTCCGCAATCTCCCTATGGACGCTAGATGCTT
GAATACGTCGATGCGGTATTACCTGGCAATAGTTCCCCCCAGCAATATTACAATTGTAGTGTTCAGTGATGTGCAGCATAGTATTGCCGAGTGGTGTCAA
GAGAAGTCGTTATAA
AA sequence
>Lus10012783 pacid=23142366 polypeptide=Lus10012783 locus=Lus10012783.g ID=Lus10012783.BGIv1.0 annot-version=v1.0
MPRYRSRSRSYSPRRRSRSPPRLRKRYDDDVDEPRDRFRESRSHRDRRSPAPSGLLVRNLPMDARCLNTSMRYYLAIVPPSNITIVVFSDVQHSIAEWCQ
EKSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18810 SCL28, At-SCL28 SC35-like splicing factor 28 (... Lus10012783 0 1
AT1G68990 MGP3 male gametophyte defective 3 (... Lus10019207 7.5 0.8822
AT1G27595 unknown protein Lus10007230 14.1 0.8733
AT3G19740 P-loop containing nucleoside t... Lus10040976 16.2 0.8641
AT2G06990 HEN2 hua enhancer 2, RNA helicase, ... Lus10022944 20.3 0.8695
AT5G35910 Polynucleotidyl transferase, r... Lus10020301 22.8 0.8332
AT5G58450 Tetratricopeptide repeat (TPR)... Lus10042248 23.8 0.8662
AT1G27595 unknown protein Lus10028229 27.1 0.8672
AT5G40480 EMB3012 embryo defective 3012 (.1) Lus10022271 27.7 0.8716
AT1G14850 NUP155 nucleoporin 155 (.1) Lus10003700 34.4 0.8663
AT3G52140 tetratricopeptide repeat (TPR)... Lus10037481 37.1 0.8523

Lus10012783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.