Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18800 181 / 8e-61 Cox19-like CHCH family protein (.1.2) AT3G06310 177 / 3e-59 Cox19-like CHCH family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033991 [exp] 215 / 2e-74 AT5G18800 181 / 6e-61 Cox19-like CHCH family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G196600 [exp] 189 / 3e-64 AT5G18800 190 / 2e-64 Cox19-like CHCH family protein (.1.2) Potri.010G026000 [exp] 184 / 7e-62 AT5G18800 192 / 3e-65 Cox19-like CHCH family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF06747 [flax] [poplar] CHCH CHCH domain
Representative CDS sequence Show only first row Show all	>Lus10012784 pacid=23142362 polypeptide=Lus10012784 locus=Lus10012784.g ID=Lus10012784.BGIv1.0 annot-version=v1.0 ATGGCTACTGCTTCGGTGGATGATTCGGGTAATCCGATCCCAACATCGGCTGTGCTGATGTCGGCGTCAAAGCACATTGGGCGTAGATGCTTTGAAGAAA ATGTGGCGTTCATCAAGTGTAAGAAGCAGGATCCTAACCCTGAGAAATGCCTCGATAAAGGCCGCCATGTCACTCGCTGCGTTTTGGGCCTGCTGAAAGA TCTTCATGAGAGGTGCACGAGAGAAATGGATGATTACGTTGGCTGCATGTACTACAATACAAATGAGTTTGATCTGTGCCGCAAAGAGCAGCAGGCGTTT GAGAAGAAATGCCCTCTGTAG
AA sequence Show only first row Show all	>Lus10012784 pacid=23142362 polypeptide=Lus10012784 locus=Lus10012784.g ID=Lus10012784.BGIv1.0 annot-version=v1.0 MATASVDDSGNPIPTSAVLMSASKHIGRRCFEENVAFIKCKKQDPNPEKCLDKGRHVTRCVLGLLKDLHERCTREMDDYVGCMYYNTNEFDLCRKEQQAF EKKCPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18800			Cox19-like CHCH family protein...		Lus10012784 [exp]	0	1
AT1G16000			unknown protein		Lus10011478 [exp]	2.2	0.7979
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10019500 [exp]	4.5	0.7658
AT5G53650			unknown protein		Lus10032946 [exp]	12.7	0.7456
AT1G21720		PBC1	proteasome beta subunit C1 (.1...		Lus10004885 [exp]	17.0	0.7329
AT1G77350			unknown protein		Lus10018864 [exp]	17.5	0.7433
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	17.9	0.7645
AT1G47278			unknown protein		Lus10040837 [exp]	18.4	0.7017
AT2G28720			Histone superfamily protein (....		Lus10017456 [exp]	18.8	0.7373
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10041296 [exp]	21.0	0.7250
AT2G31490			unknown protein		Lus10027603 [exp]	21.4	0.7372

Compare expression of checked genes

Lus10012784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.