Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18790 94 / 9e-28 Ribosomal protein L33 family protein (.1) AT3G06320 94 / 9e-28 Ribosomal protein L33 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033990 [exp] 100 / 8e-27 AT2G44710 301 / 2e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G025900 [exp] 98 / 3e-29 AT5G18790 107 / 4e-33 Ribosomal protein L33 family protein (.1) Potri.001G396700 [exp] 51 / 7e-10 AT5G18790 58 / 6e-12 Ribosomal protein L33 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00471 [flax] [poplar] Ribosomal_L33 Ribosomal protein L33
Representative CDS sequence Show only first row Show all	>Lus10012786 pacid=23142354 polypeptide=Lus10012786 locus=Lus10012786.g ID=Lus10012786.BGIv1.0 annot-version=v1.0 ATGGGTGACAAGAAGAAGAAGACGTTCATGTTCATAAGGCTGATATCAGCAGCTGGGACAGGCTTCTTTTACGTGAAGAAGAAGAGCTCAAAGAAAGTGA TGGAGAAGCTTGAGTTCCGCAAGTATGATCCCAGGGTCAATCGCCATGTACTTTTCACTGAGGCAAAGATGAAATGA
AA sequence Show only first row Show all	>Lus10012786 pacid=23142354 polypeptide=Lus10012786 locus=Lus10012786.g ID=Lus10012786.BGIv1.0 annot-version=v1.0 MGDKKKKTFMFIRLISAAGTGFFYVKKKSSKKVMEKLEFRKYDPRVNRHVLFTEAKMK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18790			Ribosomal protein L33 family p...		Lus10012786 [exp]	0	1
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	1.4	0.9137
AT5G59440		ATTMPK.2, ATTMP...	ZEUS1, ARABIDOPSIS THALIANA TH...		Lus10035500 [exp]	8.4	0.8424
AT2G47640			Small nuclear ribonucleoprotei...		Lus10030367 [exp]	8.7	0.8794
AT3G46430			unknown protein		Lus10005449 [exp]	10.0	0.8267
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	10.0	0.8791
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	12.2	0.8974
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	13.0	0.9101
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	14.4	0.9034
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10042240 [exp]	15.3	0.8880
AT3G06700			Ribosomal L29e protein family ...		Lus10016875 [exp]	15.6	0.9089

Compare expression of checked genes

Lus10012786 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.